Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0066 2.4e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 4 0.3 1.1e+04 -2.8 0.3 12 14 33 35 29 35 0.57

3 4 5.2e-10 1.9e-05 25.2 3.7 6 22 55 71 51 71 0.87

4 4 0.65 2.3e+04 -3.9 6.9 10 15 83 88 82 89 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0066	2.4e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	4	0.3	1.1e+04	-2.8	0.3	12	14	33	35	29	35	0.57
3	4	5.2e-10	1.9e-05	25.2	3.7	6	22	55	71	51	71	0.87
4	4	0.65	2.3e+04	-3.9	6.9	10	15	83	88	82	89	0.83

Coding Sequence: ATGTCTGACGATGGTTCAGCTGTTGTAGAGAAGAAAGGACGCGGCAGACCTAAAGCTAATGGAACACAAGCGGAGGCCAAAGGTGACAGCAAGAAAAGAGGAAGACAACCAGCACCAGCCAGAACTAAAGAATCAGCAAAATCGTCAGATGATGAGCAAGCACCCATAGCAAAAAGAGGACGAGGACGGCCTAAGGGTTCCAAGAAAAAGGGATCTGCGAGAGGAAAGAGTGCACCAGTTGAAGGACGGGGACGTGgacgaccacgtaaggacccaGCGCCACCTAAAAAAGATGCTGCCTCAACTGAAGAGGAACAGGACGAAGATGATGAAGATGAGGGTTCTGAAGAACAGTAA
Protein Sequence: MSDDGSAVVEKKGRGRPKANGTQAEAKGDSKKRGRQPAPARTKESAKSSDDEQAPIAKRGRGRPKGSKKKGSARGKSAPVEGRGRGRPRKDPAPPKKDAASTEEEQDEDDEDEGSEEQ*

Sequence clustering based on sequence similarity using MMseqs2