Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 6.4 2e+03 -0.7 0.1 80 108 106 134 98 136 0.72

2 3 8e-24 2.4e-21 76.2 0.1 10 108 187 285 179 287 0.92

3 3 0.12 35 4.9 0.1 79 109 288 318 281 319 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	6.4	2e+03	-0.7	0.1	80	108	106	134	98	136	0.72
2	3	8e-24	2.4e-21	76.2	0.1	10	108	187	285	179	287	0.92
3	3	0.12	35	4.9	0.1	79	109	288	318	281	319	0.87

Coding Sequence: ATGTTCGAACCAAATGTAGGAGAACCTGCAGCAAATAAACTTAATGTCACGGATACAGATGTGGTGTTTGGACACCGTGTATGTCAGACGAGTAATGTTAAGTGGCTGTGTCTCTACAACATATACCAGAAGTTTTACCGCCCCAATTTCTACGATATTGGCGGCACTTACATGCAGGATGTAGCGGATTACTGGTTCACGTACAAAACAGAACAAGTCGGTAACACATTCCTTTTGCATTTGTTTATCTGTAATCACGGAGTAAGCTCCTTCAGTGTGGCTCTTAGCTGTGGCAATAAATTCAAAGTTGACAAGAAAACCGACATAGTATACTTACAACAATACCTCACCGAGTTCCAGTTCAAACAACTAATACAAATGTCCCACACTTATCTCACAACCTACAGTTTCACAGAACTTGACATACAATGTTTGAAAAACAGAAAATTGTATATAGCTGCCTCATTTCCATTTTCAAATTCAGAAGGAGTGAGTCTAGCAGTCATTGATAACATCAAACTCAACCATGACTGCAGTGCCCTGTTTGCTGATCCAATTGGCTCAGATTTTGTGATAGAATCTGCAGATGGAGTCAAGTTTCAGATCCACAAAGTTATACTTGCTGCACACAGTGAAGTGTTCAAAGCAATGCTTAAAGGAGAGACTGCCGAAAGCCAGAACAGCTATGTGAAACTTATTGATGTTAGTGGAGAGGACCTCCGGTATATGCTTGAGTATATTTATACTGGAACAGTCAAGGATGTAGATAATACTAACTTTGCCAGTTTACTTATGCTGGCAGACAGATACAACTTAAAAGGTTTGTGGGAACTCTCTGAGTATGCTCTATCTGAGCACATGACTGTAGATAATGCTCTAGATATTTTAATTGTTGCTGATATGTATGACTCAGATTTCCTTAAGACTGAAGCTATGAAATTTATTAAAGAAAATAAAGAGATTCTTAATGGTAGTTCTTTTAGTGAGATAAATAATGCAGATTTACTCAAGCAATTGTGTACTTATTTAGCATCATAG
Protein Sequence: MFEPNVGEPAANKLNVTDTDVVFGHRVCQTSNVKWLCLYNIYQKFYRPNFYDIGGTYMQDVADYWFTYKTEQVGNTFLLHLFICNHGVSSFSVALSCGNKFKVDKKTDIVYLQQYLTEFQFKQLIQMSHTYLTTYSFTELDIQCLKNRKLYIAASFPFSNSEGVSLAVIDNIKLNHDCSALFADPIGSDFVIESADGVKFQIHKVILAAHSEVFKAMLKGETAESQNSYVKLIDVSGEDLRYMLEYIYTGTVKDVDNTNFASLLMLADRYNLKGLWELSEYALSEHMTVDNALDILIVADMYDSDFLKTEAMKFIKENKEILNGSSFSEINNADLLKQLCTYLAS

Sequence clustering based on sequence similarity using MMseqs2