Sric015696.1
Basic Information
- Insect
- Samia ricini
- Gene Symbol
- dmd-4
- Assembly
- None
- Location
- BLXV01000003:22445931-22455502[+]
Transcription Factor Domain
- TF Family
- DM
- Domain
- DM domain
- PFAM
- PF00751
- TF Group
- Zinc-Coordinating Group
- Description
- The DM domain is named after dsx and mab-3 [2]. dsx contains a single amino-terminal DM domain, whereas mab-3 contains two amino-terminal domains. The DM domain has a pattern of conserved zinc chelating residues C2H2C4 [1]. The dsx DM domain has been shown to dimerise and bind palindromic DNA [3].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 8.9e-25 6e-21 74.2 9.6 1 47 8 54 8 54 0.98 2 2 0.19 1.3e+03 -0.5 6.2 2 11 292 301 291 302 0.90
Sequence Information
- Coding Sequence
- atgaactctaatgctaaagcgcgtataccaaaatgtgcgcgatgccgcaatcacggtctcatatccagcctacgggggcacaagaaggcttgcatctaccgacaatgtcaatgccccaagtgtggacttataaaagaaagacaaaggatcatggcggctcaggtggcacttaagaggcaacaagcagctgaagacaaaatagctttacatttagcgtccgtcgagactgggacgccgttagacgccttacccccaggacgcatttatggcatgagggtaacggaaccttgtcctagttctggactagaaccagattcagcagctgatgatcacactttaattcatatagacagcgagacaagcgattcaattccagattgttgcagtaatactccagacactgcgtccgcctcttcagcatttaatacattgcgtaatcaacaatttaacaatgctgttattgaagacgtaactgccagtgacgctacagttagtactgctgggcttgaaatgcttcgtaagctgttccccggcaagaagcgatcagtattggaactagttctgcgccgttgcaaccatgacttgctgcgtgctatagagcatttcaatgccacccatgtccagcgagacaaagtaccagacacaagcgattcgagtttcgaaggatcagtgtcaagttctgaagaggctgaatcgagatggtcagcgtttcgtcctgtcggtaggcgcgctccgctgttgcctgcgctagtgatggggagagtatgcggttctgaatggctggttccgctaccggcgttgccagcattatccggacctttgctattaccattgcagcatcaacacactacaccggttcttcgtaacccttgcacacctgattgccgacagtgcaataatcatcactaa
- Protein Sequence
- MNSNAKARIPKCARCRNHGLISSLRGHKKACIYRQCQCPKCGLIKERQRIMAAQVALKRQQAAEDKIALHLASVETGTPLDALPPGRIYGMRVTEPCPSSGLEPDSAADDHTLIHIDSETSDSIPDCCSNTPDTASASSAFNTLRNQQFNNAVIEDVTASDATVSTAGLEMLRKLFPGKKRSVLELVLRRCNHDLLRAIEHFNATHVQRDKVPDTSDSSFEGSVSSSEEAESRWSAFRPVGRRAPLLPALVMGRVCGSEWLVPLPALPALSGPLLLPLQHQHTTPVLRNPCTPDCRQCNNHH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00662271;
- 90% Identity
- iTF_00112543;
- 80% Identity
- -