Rped013824.1
Basic Information
- Insect
- Riptortus pedestris
- Gene Symbol
- -
- Assembly
- GCA_019009955.1
- Location
- GWHBAZH00000005:147417400-147418146[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.0012 0.97 9.7 0.1 19 48 37 66 27 70 0.88 2 6 0.0084 6.6 7.0 0.7 20 49 67 96 64 100 0.85 3 6 0.017 13 6.0 0.3 20 48 96 124 92 125 0.83 4 6 7.7e-06 0.0061 16.7 0.5 19 48 124 153 120 156 0.91 5 6 0.00022 0.17 12.1 0.5 21 48 155 182 151 185 0.87 6 6 0.0015 1.2 9.4 0.7 21 48 184 211 181 217 0.86
Sequence Information
- Coding Sequence
- ATGAAATGGTCATCAGGAATTGCCGCTGACAAGGAACATTCTTCCTACTTTGAATGCAATTACAGCTCAAGTTTTAAACCCTCCTTAAAACACCACATACAGGTTAAACATTCAAGTGACAAACCTCACTCCTGCCCCTTTTGTGATTATAGTACTGTTCAAGCTGTCGATCTAAAGTTTCACATACAAGCAAAACATTCAAGTGACAAATCTCACTCCTGCCCTTACTGTGAATACAGAACTGTTCAGGCTGGCCATCTAAACCGTCACATACAGACCAAACATTCAAGTGTCAAACCTCACTCATGCCCCTACTGTGAATACAGTGCTGTTCAGGCAGGCGATCTAAAGCACCACGTACTAGCTAAACATTCTAGTGAGAAACCTTACTCCTGCCCCTACTGCGAATACCATACTGTTCAGACTATCAATCTAAAACGGCACATACAGGCCAAACATTCAAATGACAAACCTCACCCCTGCCCCTACTGTGAGTACAGCAGTGTTCAGGCTGTCAACCTAAAGCGTCACATACAGGCTAAGCATTCTACGGACAGACCACATTCATGCCCCTACTGTAAATACAGTTCTGTTCAGGCTGGCCATCTAAAGCGTCACGTAAAGGCGAAACATTCAAGAAACAAACCCCCCTCCTTCTCCTACTGTGAATACAGTACTAATCCGGGATACAATCTGGAGGGTCACAACTGGCTAAGCACCCAAGAGACAAATCTCCCTTACAGCTAA
- Protein Sequence
- MKWSSGIAADKEHSSYFECNYSSSFKPSLKHHIQVKHSSDKPHSCPFCDYSTVQAVDLKFHIQAKHSSDKSHSCPYCEYRTVQAGHLNRHIQTKHSSVKPHSCPYCEYSAVQAGDLKHHVLAKHSSEKPYSCPYCEYHTVQTINLKRHIQAKHSNDKPHPCPYCEYSSVQAVNLKRHIQAKHSTDRPHSCPYCKYSSVQAGHLKRHVKAKHSRNKPPSFSYCEYSTNPGYNLEGHNWLSTQETNLPYS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01309778;
- 90% Identity
- iTF_01309778;
- 80% Identity
- iTF_01309778;