Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0012 0.97 9.7 0.1 19 48 37 66 27 70 0.88

2 6 0.0084 6.6 7.0 0.7 20 49 67 96 64 100 0.85

3 6 0.017 13 6.0 0.3 20 48 96 124 92 125 0.83

4 6 7.7e-06 0.0061 16.7 0.5 19 48 124 153 120 156 0.91

5 6 0.00022 0.17 12.1 0.5 21 48 155 182 151 185 0.87

6 6 0.0015 1.2 9.4 0.7 21 48 184 211 181 217 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0012	0.97	9.7	0.1	19	48	37	66	27	70	0.88
2	6	0.0084	6.6	7.0	0.7	20	49	67	96	64	100	0.85
3	6	0.017	13	6.0	0.3	20	48	96	124	92	125	0.83
4	6	7.7e-06	0.0061	16.7	0.5	19	48	124	153	120	156	0.91
5	6	0.00022	0.17	12.1	0.5	21	48	155	182	151	185	0.87
6	6	0.0015	1.2	9.4	0.7	21	48	184	211	181	217	0.86

Coding Sequence: ATGAAATGGTCATCAGGAATTGCCGCTGACAAGGAACATTCTTCCTACTTTGAATGCAATTACAGCTCAAGTTTTAAACCCTCCTTAAAACACCACATACAGGTTAAACATTCAAGTGACAAACCTCACTCCTGCCCCTTTTGTGATTATAGTACTGTTCAAGCTGTCGATCTAAAGTTTCACATACAAGCAAAACATTCAAGTGACAAATCTCACTCCTGCCCTTACTGTGAATACAGAACTGTTCAGGCTGGCCATCTAAACCGTCACATACAGACCAAACATTCAAGTGTCAAACCTCACTCATGCCCCTACTGTGAATACAGTGCTGTTCAGGCAGGCGATCTAAAGCACCACGTACTAGCTAAACATTCTAGTGAGAAACCTTACTCCTGCCCCTACTGCGAATACCATACTGTTCAGACTATCAATCTAAAACGGCACATACAGGCCAAACATTCAAATGACAAACCTCACCCCTGCCCCTACTGTGAGTACAGCAGTGTTCAGGCTGTCAACCTAAAGCGTCACATACAGGCTAAGCATTCTACGGACAGACCACATTCATGCCCCTACTGTAAATACAGTTCTGTTCAGGCTGGCCATCTAAAGCGTCACGTAAAGGCGAAACATTCAAGAAACAAACCCCCCTCCTTCTCCTACTGTGAATACAGTACTAATCCGGGATACAATCTGGAGGGTCACAACTGGCTAAGCACCCAAGAGACAAATCTCCCTTACAGCTAA
Protein Sequence: MKWSSGIAADKEHSSYFECNYSSSFKPSLKHHIQVKHSSDKPHSCPFCDYSTVQAVDLKFHIQAKHSSDKSHSCPYCEYRTVQAGHLNRHIQTKHSSVKPHSCPYCEYSAVQAGDLKHHVLAKHSSEKPYSCPYCEYHTVQTINLKRHIQAKHSNDKPHPCPYCEYSSVQAVNLKRHIQAKHSTDRPHSCPYCKYSSVQAGHLKRHVKAKHSRNKPPSFSYCEYSTNPGYNLEGHNWLSTQETNLPYS

Sequence clustering based on sequence similarity using MMseqs2