Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.025 1.5 9.5 0.8 5 23 18 37 16 37 0.95

2 7 0.014 0.8 10.4 0.6 1 23 43 66 43 66 0.92

3 7 1.6e-05 0.00095 19.6 2.7 1 23 72 95 72 95 0.97

4 7 0.001 0.059 13.9 0.6 1 23 101 124 101 124 0.92

5 7 0.00014 0.0079 16.7 1.4 1 23 130 153 130 153 0.96

6 7 2e-05 0.0012 19.3 0.3 1 23 159 182 159 182 0.94

7 7 0.0001 0.0059 17.1 2.8 1 23 188 211 188 211 0.94

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.025	1.5	9.5	0.8	5	23	18	37	16	37	0.95
2	7	0.014	0.8	10.4	0.6	1	23	43	66	43	66	0.92
3	7	1.6e-05	0.00095	19.6	2.7	1	23	72	95	72	95	0.97
4	7	0.001	0.059	13.9	0.6	1	23	101	124	101	124	0.92
5	7	0.00014	0.0079	16.7	1.4	1	23	130	153	130	153	0.96
6	7	2e-05	0.0012	19.3	0.3	1	23	159	182	159	182	0.94
7	7	0.0001	0.0059	17.1	2.8	1	23	188	211	188	211	0.94

Coding Sequence: ATGAAATGGTCATCAGGAATTGCCGCTGACAAGGAACATTCTTCCTACTTTGAATGCAATTACAGCTCAAGTTTTAAACCCTCCTTAAAACACCACATACAGGTTAAACATTCAAGTGACAAACCTCACTCCTGCCCCTTTTGTGATTATAGTACTGTTCAAGCTGTCGATCTAAAGTTTCACATACAAGCAAAACATTCAAGTGACAAATCTCACTCCTGCCCTTACTGTGAATACAGAACTGTTCAGGCTGGCCATCTAAACCGTCACATACAGACCAAACATTCAAGTGTCAAACCTCACTCATGCCCCTACTGTGAATACAGTGCTGTTCAGGCAGGCGATCTAAAGCACCACGTACTAGCTAAACATTCTAGTGAGAAACCTTACTCCTGCCCCTACTGCGAATACCATACTGTTCAGACTATCAATCTAAAACGGCACATACAGGCCAAACATTCAAATGACAAACCTCACCCCTGCCCCTACTGTGAGTACAGCAGTGTTCAGGCTGTCAACCTAAAGCGTCACATACAGGCTAAGCATTCTACGGACAGACCACATTCATGCCCCTACTGTAAATACAGTTCTGTTCAGGCTGGCCATCTAAAGCGTCACGTAAAGGCGAAACATTCAAGAAACAAACCCCCCTCCTTCTCCTACTGTGAATACAGTACTAATCCGGGATACAATCTGGAGGGTCACAACTGGCTAAGCACCCAAGAGACAAATCTCCCTTACAGCTAA
Protein Sequence: MKWSSGIAADKEHSSYFECNYSSSFKPSLKHHIQVKHSSDKPHSCPFCDYSTVQAVDLKFHIQAKHSSDKSHSCPYCEYRTVQAGHLNRHIQTKHSSVKPHSCPYCEYSAVQAGDLKHHVLAKHSSEKPYSCPYCEYHTVQTINLKRHIQAKHSNDKPHPCPYCEYSSVQAVNLKRHIQAKHSTDRPHSCPYCKYSSVQAGHLKRHVKAKHSRNKPPSFSYCEYSTNPGYNLEGHNWLSTQETNLPYS

Sequence clustering based on sequence similarity using MMseqs2