Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.45 5.9e+02 1.1 0.2 17 44 97 121 88 121 0.81

2 6 0.029 38 4.9 8.3 6 38 115 144 110 149 0.82

3 6 2.4e-06 0.0032 17.9 2.4 1 39 139 173 139 180 0.91

4 6 0.0014 1.8 9.1 0.2 13 39 178 201 174 205 0.85

5 6 0.00021 0.28 11.7 2.2 1 41 195 231 195 233 0.86

6 6 7.9e-05 0.1 13.1 1.0 2 40 224 258 223 260 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.45	5.9e+02	1.1	0.2	17	44	97	121	88	121	0.81
2	6	0.029	38	4.9	8.3	6	38	115	144	110	149	0.82
3	6	2.4e-06	0.0032	17.9	2.4	1	39	139	173	139	180	0.91
4	6	0.0014	1.8	9.1	0.2	13	39	178	201	174	205	0.85
5	6	0.00021	0.28	11.7	2.2	1	41	195	231	195	233	0.86
6	6	7.9e-05	0.1	13.1	1.0	2	40	224	258	223	260	0.88

Coding Sequence: ATGCAGTCGAATACTCCAATGACAAACGATCACCGTAAACTCTCCACCGAAATAATGAATCTGAACGCTTCATTATGGATGGATAATCACATGATGATTATGCCAGAAGTAGTATTGAACGAAGACAAAAAAGACAAATGCGATAGTTACCCAGCCATCAACACATCGATAATTCTACAACCAGTAGAACTATTCGCACCGTCGAAAACACTCGAGCTTCCCAAAGAGACTCAAATTTTCGACCACCATCTCTCCGATCCTGACAAACTGAAACCCATCGGCGGGCCAGTATCTTGTACCTggtgtaaaattgaatttgctGATAAGAACGTCCTACTCGACCATATTAAACAGAACCATCGAGTCGATCGAGTTCACAAATGCCACCATTGTTCTAAAATATTTACGCAGAAATCGAATCTAAAAGCCCATTACAGATTGCACACGGGCGAGAAACCATTTAAATGCACATATTGCACGAAAACGTTTGCTCAGAAGAGTAACCTGATAAATCATCTTTCCGTGCATACTCGAGATAAACCATTCGAGTGCCCTATTTGTAAGCGAGCTTTCTCTCAGAGATCTAATTTGAAAAGTCATATATTCACACATACCGGCGAAAAACCCTACAAATGTAATATGTGCAGTAAAGAATTCGTACAGAAATCAAATCTCGTCAGTCATGTGAGAACACATACGGCTGAAAAACCTCACCGATGTGATatttgcgataaatattttaGTCAGCGTTCCAATTTAATTAGTCATTTGAAATTACACGCCAAAGTTAACCCTACGtag
Protein Sequence: MQSNTPMTNDHRKLSTEIMNLNASLWMDNHMMIMPEVVLNEDKKDKCDSYPAINTSIILQPVELFAPSKTLELPKETQIFDHHLSDPDKLKPIGGPVSCTWCKIEFADKNVLLDHIKQNHRVDRVHKCHHCSKIFTQKSNLKAHYRLHTGEKPFKCTYCTKTFAQKSNLINHLSVHTRDKPFECPICKRAFSQRSNLKSHIFTHTGEKPYKCNMCSKEFVQKSNLVSHVRTHTAEKPHRCDICDKYFSQRSNLISHLKLHAKVNPT

Sequence clustering based on sequence similarity using MMseqs2