Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.043 26 6.0 0.1 20 46 4 29 2 33 0.82

2 10 0.0025 1.5 10.0 0.4 23 44 35 56 28 64 0.85

3 10 0.099 59 4.9 0.1 21 44 61 84 58 91 0.90

4 10 2.6 1.5e+03 0.3 0.0 22 45 90 113 86 116 0.84

5 10 0.0029 1.7 9.8 0.3 20 44 116 140 110 149 0.85

6 10 1.9 1.1e+03 0.8 0.1 22 44 146 168 142 172 0.87

7 10 0.054 32 5.7 0.1 21 49 173 200 170 204 0.87

8 10 0.13 77 4.5 0.1 22 48 202 227 198 232 0.86

9 10 0.39 2.3e+02 2.9 0.1 21 44 229 252 225 257 0.87

10 10 0.28 1.7e+02 3.4 0.1 21 44 257 280 253 286 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.043	26	6.0	0.1	20	46	4	29	2	33	0.82
2	10	0.0025	1.5	10.0	0.4	23	44	35	56	28	64	0.85
3	10	0.099	59	4.9	0.1	21	44	61	84	58	91	0.90
4	10	2.6	1.5e+03	0.3	0.0	22	45	90	113	86	116	0.84
5	10	0.0029	1.7	9.8	0.3	20	44	116	140	110	149	0.85
6	10	1.9	1.1e+03	0.8	0.1	22	44	146	168	142	172	0.87
7	10	0.054	32	5.7	0.1	21	49	173	200	170	204	0.87
8	10	0.13	77	4.5	0.1	22	48	202	227	198	232	0.86
9	10	0.39	2.3e+02	2.9	0.1	21	44	229	252	225	257	0.87
10	10	0.28	1.7e+02	3.4	0.1	21	44	257	280	253	286	0.87

Coding Sequence: ATGACGTCGCACGCGGACAAGTCCTTCGCCTGCGACgtctgcgattacaagtgccgaaAATCGGCGGACCTGAAGCGGCACAGGTTGAAACACGCCGAAGGCAAGCCCTTCACCTGCGGCCACTGCGATTACAGATGCCGATATTCGGAGAATTTAAAGCGACACATgctgacgcacaccgacgagaagccgctgAATTGCAcgctctgcgattacaaatgccgacagtACGGGAGCTTGAAAAAGCACGTGCTgtcgcacaccggcgagaagcagTTCAGCTGCGAGGTTTGCGGCTGCAAGTTCGAGGAAAACGGGAAGCTGAAACGGCACATGTCGGTGCACACGGGCGAGAGACCGTTTAGctgtgacctctgcgattacaagtgtcgGCAGCCGGGGTATTTACGGCGGCACatgttaacgcacaccgacgacaAACCCTTCagctgtgatctctgcgattataaatgccgataCCCGGAAAGCATGAAGCGGCACGTGCTGACGCACACTGgggagaagccgttcagctgcgaccattgcgattataaatgcgtGCAATCGACATATTTGAAGCAGCACCTCTTGACGCACTTCGACGACAAGCCGTTCAGCTGCGATCTTTGCGACTACAAGTGCCGAAAATCGGCGTATCTAAAGCAGCACATGTTGAAGCACACCGGagagaagccgttcagctgcgactattgcgattacaaatgtcggCAACTCACAAGCTTGAAGCAGCACACGCTGcagcacaccggcgagaaaccgttcattTGTAAactctgcgattacaagtgccgacaACCCGGAAGGTTGAAAGAGCACGTGTTgaagcacaccggcgagaagacTTTGAATTGTGACAATTCCGGAGCATGA
Protein Sequence: MTSHADKSFACDVCDYKCRKSADLKRHRLKHAEGKPFTCGHCDYRCRYSENLKRHMLTHTDEKPLNCTLCDYKCRQYGSLKKHVLSHTGEKQFSCEVCGCKFEENGKLKRHMSVHTGERPFSCDLCDYKCRQPGYLRRHMLTHTDDKPFSCDLCDYKCRYPESMKRHVLTHTGEKPFSCDHCDYKCVQSTYLKQHLLTHFDDKPFSCDLCDYKCRKSAYLKQHMLKHTGEKPFSCDYCDYKCRQLTSLKQHTLQHTGEKPFICKLCDYKCRQPGRLKEHVLKHTGEKTLNCDNSGA

Sequence clustering based on sequence similarity using MMseqs2