Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0021 32 6.0 0.3 12 38 19 45 13 57 0.77

2 5 0.2 3e+03 -0.3 0.0 26 45 64 83 55 90 0.79

3 5 0.00023 3.5 9.1 0.1 22 48 88 114 83 118 0.85

4 5 1.2e-05 0.18 13.3 0.1 21 52 115 146 111 146 0.88

5 5 0.00077 12 7.5 0.0 21 48 143 170 141 174 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0021	32	6.0	0.3	12	38	19	45	13	57	0.77
2	5	0.2	3e+03	-0.3	0.0	26	45	64	83	55	90	0.79
3	5	0.00023	3.5	9.1	0.1	22	48	88	114	83	118	0.85
4	5	1.2e-05	0.18	13.3	0.1	21	52	115	146	111	146	0.88
5	5	0.00077	12	7.5	0.0	21	48	143	170	141	174	0.89

Coding Sequence: ATGTATGGAATAAGGACCCCAGTAAGACTGATATCCAAAGATGAAGCGGCCAGTTCAGAGGAGCCCTACGCGAAACGTAAAAGTAGCCCCCTCGAGAAGTGCCCCATTTGTAAAAAGTTTTTCCGAAGGATGAAAACCCACCTTACTAAGCACGAAATATTGCAGAACCAAGAGGCTTGTTCGGGACTGATCTGTGAAATTTGTAATAAGGCTTTTAATAATCATAGtaatttattaatacatatgaGGACCCATACAGGAGATAAACCCTATGCCTGTGAGGTGTGTAATAAGTCATTCTCTCAAAGTTGTAATTTGGTGAACCATATGAGGATTCATACAGGCGAAAAACCCTTTAAGTGCCCGCACTGCGACAGGGCCTTTACCCAATCGGGGAACCTCAATAATCATATTCGTCTCCACACAGACGAGAAACCTTTCAAATGTCACTTTTGTGACAAAGCGTTCGTGCAAAGTGGAAATCTCAATTCTCACATCAGGAATAACCATAGGTTTAGGGAGTATCAGGAAAGGAAAAATGCAGTACTTTCGTAG
Protein Sequence: MYGIRTPVRLISKDEAASSEEPYAKRKSSPLEKCPICKKFFRRMKTHLTKHEILQNQEACSGLICEICNKAFNNHSNLLIHMRTHTGDKPYACEVCNKSFSQSCNLVNHMRIHTGEKPFKCPHCDRAFTQSGNLNNHIRLHTDEKPFKCHFCDKAFVQSGNLNSHIRNNHRFREYQERKNAVLS

Sequence clustering based on sequence similarity using MMseqs2