Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0067 1.8e+02 3.9 0.1 17 37 56 76 50 87 0.70

2 5 0.24 6.1e+03 -1.1 0.0 27 47 97 117 94 124 0.75

3 5 0.00011 2.8 9.6 0.7 22 48 120 146 111 150 0.84

4 5 1e-05 0.26 12.9 0.1 21 52 147 178 143 178 0.88

5 5 0.0005 13 7.5 0.0 21 48 175 202 172 206 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0067	1.8e+02	3.9	0.1	17	37	56	76	50	87	0.70
2	5	0.24	6.1e+03	-1.1	0.0	27	47	97	117	94	124	0.75
3	5	0.00011	2.8	9.6	0.7	22	48	120	146	111	150	0.84
4	5	1e-05	0.26	12.9	0.1	21	52	147	178	143	178	0.88
5	5	0.0005	13	7.5	0.0	21	48	175	202	172	206	0.89

Coding Sequence: ATGAGACTTTTTAGAAAGGATTCTTTCAGTGATGATTTAAAGCAGATAGATAGTTATGACatgaaaatgaaaagaaaatttagcCTGAGTCATAAGTCTCCAGGTATCAGGACTCCCGTACGGTTGGTTTCAAAGGATGAAGCGTTGAATGCTGAAGAAACATAtacaagaagaaaaagtagtCCTTTAGAAATGTGTCCCATATGCAAAAAGTATTTTAGAAGGATGAAGACTCACCTTCTGAAGCACGAAGTGTTGCAGGATGGTAATGAAGTGAATACTTTTATTTGCGAGCTATGTTCTAAAGCCTTCAACAATCAAAGTAATTTGCAAATTCACATGAGGACCCACACAGGACAGAAACCGTACATCTGCGAAATATGCACAAAATGCTTCTCGCAAAGTTGTAATCTAGTCAATCACATGAGGATTCACACCGGCGAAAAACCATTCAAGTGTCCGCACTGTGATAGAGCCTTCACCCAGTCGGGTAATCTCAACAATCACATCCGGCTTCACACGGACGAGAAACCTTTCAAGTGTCACTTTTGCGATAAGGCCTTCGTACAGAGCGGAAATTTAAATTCACACATACGAAACAATCACAGGTTAAAAGGATTCTCTCAGATGTCCGGAGAGGCAATGATGACttag
Protein Sequence: MRLFRKDSFSDDLKQIDSYDMKMKRKFSLSHKSPGIRTPVRLVSKDEALNAEETYTRRKSSPLEMCPICKKYFRRMKTHLLKHEVLQDGNEVNTFICELCSKAFNNQSNLQIHMRTHTGQKPYICEICTKCFSQSCNLVNHMRIHTGEKPFKCPHCDRAFTQSGNLNNHIRLHTDEKPFKCHFCDKAFVQSGNLNSHIRNNHRLKGFSQMSGEAMMT

Sequence clustering based on sequence similarity using MMseqs2