Pdol005358.1
Basic Information
- Insect
- Plagodis dolabraria
- Gene Symbol
- Hr39_1
- Assembly
- GCA_963854805.1
- Location
- OY978441.1:33132285-33138681[+]
Transcription Factor Domain
- TF Family
- SF-like
- Domain
- zf-C4|SF-like
- PFAM
- AnimalTFDB
- TF Group
- Zinc-Coordinating Group
- Description
- The ligand binding domain of nuclear receptor steroidogenic factor 1 (SF-1): SF-1, a member of the nuclear hormone receptor superfamily, is an essential regulator of endocrine development and function and is considered a master regulator of reproduction. Most nuclear receptors function as homodimer or heterodimers, however SF-1 binds to its target genes as a monomer, recognizing the variations of the DNA sequence motif, T/CCA AGGTCA. SF-1 functions cooperatively with other transcription factors to modulate gene expression. Phospholipids have been determined as potential ligands of SF-1. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, SF-1 has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). [1, 8, 3, 11, 6, 5, 12, 10, 9, 2, 4, 7]
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 8.6e-50 1.8e-45 157.9 0.0 236 408 3 176 1 176 0.95
Sequence Information
- Coding Sequence
- ATGTTTAAGTTCAAGATAGACGATCAAATCTGCCTGCTGATCAACAGCTGGTGCGAGCTCCTGGTGCTGTCGTGCTGCTACCGCGGAGTGAGTACGCCGGGTGAGGTTCGCGTCGGCGGTGGACGTGGCATCACTCTACAGCAGAGTGCCAAACTGGGCCTGACGCCGTGCATAGAACGAATGCTGAGCTTCACAGACCACTTGAGAAGACTCCGAGTGGACCGGTACGAGTACGTGGCCTTGAAGGTGATCGTCCTGCTCACGTCAGATGCACCTGAACTGCGTGAAGCAGAGAAAGTGCGAGCATCCCAAGAGAAGGCATTAGCAGCGCTTCAGGCGTACATCGCGACACATTCCCCACAGACGCCGGCCAAGTTCGGCGAACTGTTGCTGCGCATTCCTGAGCTGCAGAGGACTTGTCAGTTCTTCATGCAAGTCGGCAAAGAGATGCTCAACCCAGCGAATAAAAACAAAGATGGCGATGGACCAAGCTTCAACCTTCTAATGGAACTCCTTAGAGGTGATCATTGA
- Protein Sequence
- MFKFKIDDQICLLINSWCELLVLSCCYRGVSTPGEVRVGGGRGITLQQSAKLGLTPCIERMLSFTDHLRRLRVDRYEYVALKVIVLLTSDAPELREAEKVRASQEKALAALQAYIATHSPQTPAKFGELLLRIPELQRTCQFFMQVGKEMLNPANKNKDGDGPSFNLLMELLRGDH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00119693;
- 90% Identity
- iTF_00724017;
- 80% Identity
- iTF_00913709;