Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.00044 5.2 7.7 0.2 25 45 91 111 83 118 0.87

2 7 0.025 3e+02 2.0 0.0 23 46 117 140 112 146 0.80

3 7 0.0035 41 4.8 0.0 21 46 143 168 138 174 0.86

4 7 0.0014 16 6.1 0.0 21 46 171 196 166 202 0.86

5 7 0.00012 1.4 9.4 0.0 21 45 199 223 195 230 0.86

6 7 0.0029 34 5.0 0.1 21 44 227 250 223 258 0.86

7 7 0.016 1.9e+02 2.6 0.0 21 44 255 278 252 281 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.00044	5.2	7.7	0.2	25	45	91	111	83	118	0.87
2	7	0.025	3e+02	2.0	0.0	23	46	117	140	112	146	0.80
3	7	0.0035	41	4.8	0.0	21	46	143	168	138	174	0.86
4	7	0.0014	16	6.1	0.0	21	46	171	196	166	202	0.86
5	7	0.00012	1.4	9.4	0.0	21	45	199	223	195	230	0.86
6	7	0.0029	34	5.0	0.1	21	44	227	250	223	258	0.86
7	7	0.016	1.9e+02	2.6	0.0	21	44	255	278	252	281	0.90

Coding Sequence: ATGAAGGAAGAAGCAACAGTTAAAAAAGAATTCATTGATGTGGAAGAGAGTAAAGATTTTGAACATGACGAAGAAACAGCTGCTGAAAaagattttattgatattgagGTGAGTGCACATTTTGAACCTGAAGAAACAACAGCTAAAAAGGAATTCATTTTTATTGAGGTGAGTTCacatgttgatgatgatgatgaaccaaTAGTTAAAAAAGAATGGATTGATATTGAGGCGAGTACACATAATGTACAATATAAAGAAGCAACAGCTAAAACTTGTAACATATGCAGCAAAACAGTTTCCCACAGTCGCTATTTGAAATTACATATGAAAACTCATACGAGAGAGAAAAGATATGCTTGCGAAAAATGCAGCAAATCATTTAGTGATTCTGCTAATTTGAAAAAACATATACGAACTCACACTGGTGAAAAGCCATATGCTTGCAAAGAATGCGGCAGAGCATTTAGTGACTCCGgtaatttaaaacaacatatGAAAACTCACAccggagaaaagccatatgcttgCGGGCAATGCCCCAAATCATTTGGTGATTCTtgcaacttaaaaaaacacctacGAACACACACTGGTGAAAAACCATACTCCTGTGATATATGCAGCAAATCGTTTAATGATTCTGGTAATTTGAAACAGCATGTACGAACTCACACTGGTGAAAAGCCATATCCTTGCAACAGATGCAGCAAATCATTTTCTCaagctagtaatttaaaacAGCACATGCTGACGCATACTGGAGAGAAGCCATATGCTTGTAGCAAATGCGGTAAATCATTTGGGATTTCTGGTAATTTGAAAAAGCATATGCGAAGTCACACTGAAGATTAG
Protein Sequence: MKEEATVKKEFIDVEESKDFEHDEETAAEKDFIDIEVSAHFEPEETTAKKEFIFIEVSSHVDDDDEPIVKKEWIDIEASTHNVQYKEATAKTCNICSKTVSHSRYLKLHMKTHTREKRYACEKCSKSFSDSANLKKHIRTHTGEKPYACKECGRAFSDSGNLKQHMKTHTGEKPYACGQCPKSFGDSCNLKKHLRTHTGEKPYSCDICSKSFNDSGNLKQHVRTHTGEKPYPCNRCSKSFSQASNLKQHMLTHTGEKPYACSKCGKSFGISGNLKKHMRSHTED

Sequence clustering based on sequence similarity using MMseqs2