Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.0008 6.7 7.4 0.2 25 45 95 115 89 122 0.88

2 7 0.04 3.4e+02 1.9 0.0 24 46 122 144 117 150 0.80

3 7 0.0057 47 4.7 0.0 21 46 147 172 143 178 0.86

4 7 0.0035 29 5.3 0.0 21 45 175 199 171 203 0.91

5 7 0.00019 1.6 9.4 0.0 21 45 203 227 199 234 0.86

6 7 0.004 33 5.2 0.1 21 44 231 254 226 263 0.85

7 7 0.015 1.3e+02 3.3 0.0 21 44 259 282 255 286 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.0008	6.7	7.4	0.2	25	45	95	115	89	122	0.88
2	7	0.04	3.4e+02	1.9	0.0	24	46	122	144	117	150	0.80
3	7	0.0057	47	4.7	0.0	21	46	147	172	143	178	0.86
4	7	0.0035	29	5.3	0.0	21	45	175	199	171	203	0.91
5	7	0.00019	1.6	9.4	0.0	21	45	203	227	199	234	0.86
6	7	0.004	33	5.2	0.1	21	44	231	254	226	263	0.85
7	7	0.015	1.3e+02	3.3	0.0	21	44	259	282	255	286	0.91

Coding Sequence: ATGAAGGAAGAAACAATAGTTAAAAAAGAATTCATTGATGTGGAAGACAGTAAAGATTTTGAACATGATgaagaaacagaaaaaaatttTACAGCTGAAAAAGATTTTATTGATATTGAGGTGAGTGCACATTTTGAACCTGAAGCAACAAAAGCTAAAAAAGAATTCATTTTTATTGAAGTGAGTTCACATGTTGATGATGACGAAGAACCAACAGTTAAAAAAGAATGGATTGATATTGAGGCGAGTACACATACTGAAGAATATAAAAAAGCAACAGCTAAAACTTGTAACATATGCAGCAAAACAGTTTCCCATAGTCGCTATTTGAAACTACACATGAAAACTCATACGAGAGAGAAACGATATGCTTGCGAAAAATGCAGCAAATCATTTAGTGATTCTGCTAATTTGAAAAAACATATACGAACTCACACTGGTGAAAAGCCATATGCTTGCAAAGAATGCGGCAGAGCATTTAGTGACTCCGGTAATTTAAAACAACACATGAAAACTCACAccggagaaaagccatatgcttGCGGGCAATGCCCCAAATCATTTGGTGATTcttgtaacttaaaaaaacacctgCGAACACACACTGGTGAAAAACCATACTCCTGTGATATATGCAGCAAATCGTTTAATGATTCTGGTAATTTGAAACAGCATGTACGAACTCACACTGGAGAAAAACCATATCCTTGTAACAGATGCAGCAAATCATTTTCTCAAGCTAGTAATTTAAAACAACACATGTTGACGCATACTGGAGAGAAGCCATATGCTTGCAGCAAATGCGGCAAATCATTTGGGATGTCTGGTAATTTGAAAAAGCACATGCGAAGTCATACTGAAGATTAG
Protein Sequence: MKEETIVKKEFIDVEDSKDFEHDEETEKNFTAEKDFIDIEVSAHFEPEATKAKKEFIFIEVSSHVDDDEEPTVKKEWIDIEASTHTEEYKKATAKTCNICSKTVSHSRYLKLHMKTHTREKRYACEKCSKSFSDSANLKKHIRTHTGEKPYACKECGRAFSDSGNLKQHMKTHTGEKPYACGQCPKSFGDSCNLKKHLRTHTGEKPYSCDICSKSFNDSGNLKQHVRTHTGEKPYPCNRCSKSFSQASNLKQHMLTHTGEKPYACSKCGKSFGMSGNLKKHMRSHTED

Sequence clustering based on sequence similarity using MMseqs2