Paff013097.1
Basic Information
- Insect
- Perizoma affinitatum
- Gene Symbol
- -
- Assembly
- GCA_961405105.1
- Location
- OY560197.1:1084492-1085358[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.0008 6.7 7.4 0.2 25 45 95 115 89 122 0.88 2 7 0.04 3.4e+02 1.9 0.0 24 46 122 144 117 150 0.80 3 7 0.0057 47 4.7 0.0 21 46 147 172 143 178 0.86 4 7 0.0035 29 5.3 0.0 21 45 175 199 171 203 0.91 5 7 0.00019 1.6 9.4 0.0 21 45 203 227 199 234 0.86 6 7 0.004 33 5.2 0.1 21 44 231 254 226 263 0.85 7 7 0.015 1.3e+02 3.3 0.0 21 44 259 282 255 286 0.91
Sequence Information
- Coding Sequence
- ATGAAGGAAGAAACAATAGTTAAAAAAGAATTCATTGATGTGGAAGACAGTAAAGATTTTGAACATGATgaagaaacagaaaaaaatttTACAGCTGAAAAAGATTTTATTGATATTGAGGTGAGTGCACATTTTGAACCTGAAGCAACAAAAGCTAAAAAAGAATTCATTTTTATTGAAGTGAGTTCACATGTTGATGATGACGAAGAACCAACAGTTAAAAAAGAATGGATTGATATTGAGGCGAGTACACATACTGAAGAATATAAAAAAGCAACAGCTAAAACTTGTAACATATGCAGCAAAACAGTTTCCCATAGTCGCTATTTGAAACTACACATGAAAACTCATACGAGAGAGAAACGATATGCTTGCGAAAAATGCAGCAAATCATTTAGTGATTCTGCTAATTTGAAAAAACATATACGAACTCACACTGGTGAAAAGCCATATGCTTGCAAAGAATGCGGCAGAGCATTTAGTGACTCCGGTAATTTAAAACAACACATGAAAACTCACAccggagaaaagccatatgcttGCGGGCAATGCCCCAAATCATTTGGTGATTcttgtaacttaaaaaaacacctgCGAACACACACTGGTGAAAAACCATACTCCTGTGATATATGCAGCAAATCGTTTAATGATTCTGGTAATTTGAAACAGCATGTACGAACTCACACTGGAGAAAAACCATATCCTTGTAACAGATGCAGCAAATCATTTTCTCAAGCTAGTAATTTAAAACAACACATGTTGACGCATACTGGAGAGAAGCCATATGCTTGCAGCAAATGCGGCAAATCATTTGGGATGTCTGGTAATTTGAAAAAGCACATGCGAAGTCATACTGAAGATTAG
- Protein Sequence
- MKEETIVKKEFIDVEDSKDFEHDEETEKNFTAEKDFIDIEVSAHFEPEATKAKKEFIFIEVSSHVDDDEEPTVKKEWIDIEASTHTEEYKKATAKTCNICSKTVSHSRYLKLHMKTHTREKRYACEKCSKSFSDSANLKKHIRTHTGEKPYACKECGRAFSDSGNLKQHMKTHTGEKPYACGQCPKSFGDSCNLKKHLRTHTGEKPYSCDICSKSFNDSGNLKQHVRTHTGEKPYPCNRCSKSFSQASNLKQHMLTHTGEKPYACSKCGKSFGMSGNLKKHMRSHTED
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01170789;
- 90% Identity
- iTF_01171992;
- 80% Identity
- iTF_01170789;