Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.69 1.1e+04 -1.0 0.1 58 67 7 16 3 19 0.73

2 4 0.091 1.4e+03 1.8 0.2 32 42 52 63 35 70 0.71

3 4 5.7e-17 8.7e-13 50.5 1.0 4 70 87 153 84 153 0.96

4 4 1.4 2.1e+04 -2.0 0.1 54 60 158 164 155 165 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.69	1.1e+04	-1.0	0.1	58	67	7	16	3	19	0.73
2	4	0.091	1.4e+03	1.8	0.2	32	42	52	63	35	70	0.71
3	4	5.7e-17	8.7e-13	50.5	1.0	4	70	87	153	84	153	0.96
4	4	1.4	2.1e+04	-2.0	0.1	54	60	158	164	155	165	0.81

Coding Sequence: ATGGCATCAGCTATAGGAAAATGCAAGATATGCGGGGAACAATTGAGTTATCAACCTGACGACATTACTGCTTTCGGCAAGCATCTTatagaaaaacatattaacGATCAAATTACCCATTTCCAATTTAAAGAGAACGGTATCTCAGAAAACGGAGGGCTATGTGAATGCGGATGCGCTTGCGGTTGTAACTGCGATGAAAAGGTCAAAAGAGGAAAAGCGTACAAAACAACAGttGAAAGTTGGAAGCAAGGCTCAGCTTCCCAAGAATGTCCAAACTGCGGAAAAGTCGGATTACCCTTAATAAGGAAACAAAGAAATAAGGTATCCAAGAATTCATTCGGCACGCTTTGTTTAGTAGGATGTTGGCCATTATGCTTCCTACCATTTCTTCTGGGTGGTTCGGACATCATGTACCTATTCTGTCAGGAATGTGGTTATTTCCTAGGTACTTACGATAGAAAAACCGGAAGCATCCATCATTCTTGTCCAATTGATTCTTCTGAATATGGAgcaaaaatttgtaaatgtaatgaTCCATAG
Protein Sequence: MASAIGKCKICGEQLSYQPDDITAFGKHLIEKHINDQITHFQFKENGISENGGLCECGCACGCNCDEKVKRGKAYKTTVESWKQGSASQECPNCGKVGLPLIRKQRNKVSKNSFGTLCLVGCWPLCFLPFLLGGSDIMYLFCQECGYFLGTYDRKTGSIHHSCPIDSSEYGAKICKCNDP

Sequence clustering based on sequence similarity using MMseqs2