Obic003447.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Osmia bicornis
Gene Symbol
HMG20A
Assembly
GCA_907164935.1
Location
NC:1617449-1618562[+]

Transcription Factor Domain

TF Family
HMG
Domain
HMG_box domain
PFAM
PF00505
TF Group
Other Alpha-Helix Group
Description
High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 1.7e-17 5.9e-15 55.9 2.4 1 69 122 193 122 193 0.93

Sequence Information

Coding Sequence
ATGTCCGACGAATCGGAATATGACGTGGAACCAGAAGAGTTTGACATTTATAAACGAAAGTACCAATTGTTACTCGATAGATGTGAAGTTTTACAACAGgAAAATGAAAGATTAGTGTATCGAATTCAACGAGTAAGAAAACTTCTAAAACGTAcaaggaaggaaaaaaaatttttaattgatCGTTTGGATCAACATGGTGATCGTTGGCGGGAGGCACCCATGGGAGTTCTTGAAGAAAATAGTACGTTTCAAGTAACACCTAAACCAGAGAAAACACCAAAAGCTACTGGCCATAATTCTAAAGAGGAGAAAACAAAGaaagtaacaaaaagaaagggTACAAAAGCTGATCCTAATGCACCAAAACGACCagcaaatccattttttcaattttgtcaAGAACAAAGACCTCGTGTTATGGAACGCTTGGCTGGAGAACCAGAACCAAGCAAGCAAGAACTCACCAGACAACTCGCGACTACTTGGAAATCTCTTAGTTCAGAAGACAAAAAAGTATATTACGATATGTACGAACGATCCAAAGAAAAGTATGTTGCTGAAAtgcaaatttataataaaaaatcggAAGACACACCGAACCAAATGTCTTTAAATATAACatag
Protein Sequence
MSDESEYDVEPEEFDIYKRKYQLLLDRCEVLQQENERLVYRIQRVRKLLKRTRKEKKFLIDRLDQHGDRWREAPMGVLEENSTFQVTPKPEKTPKATGHNSKEEKTKKVTKRKGTKADPNAPKRPANPFFQFCQEQRPRVMERLAGEPEPSKQELTRQLATTWKSLSSEDKKVYYDMYERSKEKYVAEMQIYNKKSEDTPNQMSLNIT

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00303008; iTF_01123040; iTF_00182594; iTF_00181284; iTF_01245196; iTF_00181942; iTF_00266434; iTF_01508837; iTF_00265670; iTF_00265671; iTF_00829479; iTF_00265672; iTF_00262635; iTF_00263440; iTF_01364624; iTF_01299155; iTF_00828758; iTF_00439450; iTF_00058684; iTF_00293698; iTF_01475428; iTF_01473159; iTF_01474664; iTF_01473900; iTF_00298287; iTF_00294452; iTF_00296756; iTF_00292248; iTF_00295224; iTF_00295992; iTF_00291514; iTF_00297530; iTF_00292923; iTF_01004226; iTF_01005061; iTF_00377990; iTF_00378732; iTF_00380269; iTF_00379598; iTF_00381038; iTF_01003505; iTF_01006041; iTF_00381818; iTF_01476898; iTF_01477544; iTF_00983588; iTF_01419618; iTF_00438057; iTF_00438732; iTF_00168399; iTF_01273074; iTF_00728635; iTF_01273758; iTF_01103529; iTF_01102025; iTF_00873770; iTF_00230668; iTF_00014699; iTF_00016017; iTF_01476150; iTF_00015351; iTF_00756619; iTF_01129324; iTF_00221889; iTF_00279937; iTF_00769601; iTF_01306433; iTF_01492865; iTF_00011074; iTF_00898722; iTF_00982946; iTF_01077442; iTF_00214371; iTF_00225891; iTF_00625475; iTF_00117988; iTF_00228644; iTF_00754628; iTF_00760964; iTF_01228996; iTF_00215686; iTF_00222502; iTF_00227942; iTF_00391270; iTF_01067590; iTF_00232583; iTF_00253543; iTF_00881223; iTF_01066919; iTF_01394279; iTF_01266856; iTF_00280585; iTF_01130793; iTF_01405673; iTF_00109802; iTF_01523338; iTF_00880427; iTF_01065547; iTF_00223852; iTF_00141805; iTF_00142445; iTF_00220557; iTF_00226573; iTF_01391085; iTF_00064430; iTF_00733934; iTF_01069646; iTF_01269774; iTF_01270479; iTF_01391951; iTF_01420911; iTF_00219088; iTF_00252048; iTF_00264976; iTF_00770352; iTF_00128177; iTF_00140561; iTF_00183921; iTF_00216369; iTF_00224529; iTF_00229329; iTF_01417681; iTF_01454065; iTF_00460498; iTF_00684146; iTF_01390194; iTF_00459731; iTF_00730035; iTF_00765555; iTF_00868083; iTF_00882003; iTF_01423635; iTF_01068276; iTF_01100564; iTF_01102772; iTF_01267540; iTF_00214997; iTF_01271189; iTF_00230006; iTF_00233206; iTF_00264246; iTF_01198646; iTF_01408182; iTF_01422902; iTF_00227255; iTF_01268247; iTF_01407255; iTF_01408183; iTF_00141208; iTF_00221240; iTF_00866680; iTF_01418328; iTF_00200729; iTF_00217049; iTF_00231961; iTF_01068953; iTF_01101305; iTF_01199385; iTF_01354585; iTF_01498201; iTF_00218394; iTF_01066234; iTF_00730715; iTF_00885083; iTF_01421531; iTF_00773788; iTF_00879612; iTF_00882940; iTF_00982268; iTF_01393500; iTF_00254301; iTF_00729277; iTF_01418973; iTF_01493565; iTF_00183262; iTF_00675998; iTF_01395102; iTF_01420254; iTF_00217727; iTF_00223167; iTF_00225215; iTF_01228351; iTF_01389407; iTF_01409087; iTF_01539583; iTF_00219776; iTF_00231296; iTF_00684768; iTF_01269024; iTF_01422208; iTF_00690156; iTF_00691916; iTF_00691065; iTF_00692894; iTF_01254771; iTF_00252795; iTF_00255059; iTF_00867374; iTF_00868772; iTF_00938670; iTF_00939529; iTF_00175726; iTF_01015791; iTF_01406474; iTF_00127431; iTF_00125900; iTF_00016659; iTF_00128949; iTF_00129718; iTF_01355286; iTF_00126688; iTF_00452558; iTF_01537935; iTF_00047942; iTF_00046124; iTF_00046953; iTF_00350991; iTF_00938002; iTF_01232978; iTF_01233633; iTF_00306242; iTF_00633608; iTF_01234324; iTF_01089976; iTF_01120188; iTF_01235005; iTF_01232383; iTF_01492863; iTF_00397270; iTF_00398060; iTF_01056793; iTF_01057625; iTF_01055967; iTF_01379193; iTF_00050922; iTF_00798555; iTF_00966011; iTF_00865981; iTF_00087140; iTF_00763204; iTF_00864614; iTF_00087975; iTF_00085353; iTF_00862537; iTF_00860362; iTF_00862538; iTF_00865290; iTF_00863246; iTF_00084529; iTF_00086257; iTF_00024597; iTF_00863928; iTF_00861113; iTF_01169145; iTF_00861850; iTF_01071003; iTF_00762525; iTF_00088799; iTF_00964455; iTF_00961802; iTF_00963831; iTF_00962488; iTF_00963167; iTF_00393578; iTF_01255528; iTF_00360191; iTF_01424356; iTF_00360883; iTF_00676700; iTF_00980097; iTF_01099164; iTF_01303335; iTF_01087178; iTF_01520205; iTF_00417534; iTF_00719390; iTF_01200130; iTF_01392748; iTF_00718541; iTF_00316767; iTF_00317447;
90% Identity
iTF_00393578;
80% Identity
-