Ocom043523.1
Basic Information
- Insect
- Ophraella communa
- Gene Symbol
- Runx3_1
- Assembly
- GCA_035357415.1
- Location
- CM068985.1:38760773-38761213[+]
Transcription Factor Domain
- TF Family
- Runt
- Domain
- Runt domain
- PFAM
- PF00853
- TF Group
- Beta-Scaffold Factors
- Description
- The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [1]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [1]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5.8e-53 1.2e-48 166.4 0.0 2 95 52 145 51 146 0.97
Sequence Information
- Coding Sequence
- ATGATTGGTGATTGGAATCAATCCATAACCATGCATTTGACGAACACTCCTACAGGTACCAACGGTACCACCTCTAATCAAGAGGGTACCACTAATTTAATACAAGATACTTATACTAAAATGACCAGTGATATTTTGGCCGAAAGAACATTAAACGATTTCTTAAGTGAACACCCGGGTGAACTAATTAGAACAGGAAGCCCATTGTTCGTTTGTACCGTTCTACCTCCTCATTGGAGATCCAACAAGACTCTTCCTGTGGCGTTTAAAGTGGTTGCTTTGGGGGACGTTGGGGATGGGACTGTTGTGACAGTGAAAGCTGGTAACGACGAAAATTATTGTGCCGAATTAAGAAACTCGACAGCTGTAATGAAGAATCAAGTGGCAAAGTTTAATGATCTAAGGTTTGTTGGCAGAAGTGGGAGAGGTGAGAGTCCTTAA
- Protein Sequence
- MIGDWNQSITMHLTNTPTGTNGTTSNQEGTTNLIQDTYTKMTSDILAERTLNDFLSEHPGELIRTGSPLFVCTVLPPHWRSNKTLPVAFKVVALGDVGDGTVVTVKAGNDENYCAELRNSTAVMKNQVAKFNDLRFVGRSGRGESP
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00056322; iTF_00078160; iTF_00327635; iTF_00328931; iTF_00956086; iTF_01498657; iTF_00987591; iTF_01123466; iTF_01120654; iTF_00307347; iTF_00433820; iTF_00064957; iTF_00625918; iTF_00626846; iTF_01252512; iTF_00910297; iTF_01046884; iTF_00025810; iTF_00458643; iTF_00735259; iTF_00387835; iTF_01128095;
- 90% Identity
- iTF_01046884;
- 80% Identity
- -