Caur037256.1
Basic Information
- Insect
- Cetonia aurata
- Gene Symbol
- Runx3
- Assembly
- GCA_949128085.1
- Location
- OX421888.1:9874426-9874863[+]
Transcription Factor Domain
- TF Family
- Runt
- Domain
- Runt domain
- PFAM
- PF00853
- TF Group
- Beta-Scaffold Factors
- Description
- The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [1]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [1]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1e-54 1.2e-50 172.0 0.0 2 96 51 145 50 145 0.98
Sequence Information
- Coding Sequence
- ATGTTCGGTGACTGGAATACACCAACGACAATGCACCTAACAGCCAATACTCAAACGGCTACTGGAACTGCGGCATCTCCAGAAGGTACAAACATCATCAACGACACCTACACCAAAATGACGTCGGACATTTTGGCCGAAAGAACTCTCAACGATTTCTTATCGGAGCATCCTGGCGAACTCATAAGGACCGGCAGTCCGTTGTTCGTCTGCACCGTTCTACCGCCACACTGGAGGTCCAATAAGACTTTACCGGTAGCCTTCAAGGTGGTCGCGTTAGGAGATATTGGAGATGGCACTGTGGTCACTGTGAGAGCTGGGAATGATGAGAATTATTGTGCTGAATTAAGGAACTGCACGGCTGTGATGAAGAATCAGGTGGCTAAGTTTAACGACTTGAGGTTCGTTGGAAGAAGTGGCAGAGGTAAgtccttttaa
- Protein Sequence
- MFGDWNTPTTMHLTANTQTATGTAASPEGTNIINDTYTKMTSDILAERTLNDFLSEHPGELIRTGSPLFVCTVLPPHWRSNKTLPVAFKVVALGDIGDGTVVTVRAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSF
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01105349;
- 90% Identity
- iTF_01123466; iTF_01058149; iTF_00078160; iTF_00001748; iTF_00152037; iTF_00977101; iTF_01284032; iTF_01498657; iTF_01096389; iTF_01120654; iTF_00029967; iTF_00031568; iTF_01162864; iTF_00167475; iTF_00413267; iTF_01567606; iTF_01480633; iTF_00752721; iTF_01252512; iTF_00920437; iTF_01126130; iTF_00956086; iTF_01441718; iTF_01311337; iTF_01535609; iTF_00464439; iTF_00465762; iTF_00740587; iTF_01184282; iTF_01185955; iTF_01400139; iTF_00064957; iTF_00987591; iTF_00433820; iTF_00626846; iTF_00625918;
- 80% Identity
- -