Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 2.7e-20 3.5e-16 59.6 0.0 14 49 14 49 11 52 0.95

2 3 0.39 5.1e+03 -1.8 0.1 16 30 95 109 74 117 0.58

3 3 0.7 9.3e+03 -2.6 0.3 37 45 205 213 204 215 0.73

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	2.7e-20	3.5e-16	59.6	0.0	14	49	14	49	11	52	0.95
2	3	0.39	5.1e+03	-1.8	0.1	16	30	95	109	74	117	0.58
3	3	0.7	9.3e+03	-2.6	0.3	37	45	205	213	204	215	0.73

Coding Sequence: ATGATCCAACGTTTTTTCGCTCGATACCTTTCAGAGAACGATCCGAAAGGACGAAACGTTTCCGATCAGCCCACGACTTGTCCGCTCTGCGGAGCGGTCTTACGACAATCTCGAAACCTTCGCCGTCATCTGGAACTTCTTCATTTTGGACTTGGCAACAGTGGAAAAGCCGCCGCCATACGCGAGAAATCTCGAAAATCTGAGAGACTGTCGGAACCTCATCGATCCCCGTTGCCGCCTACCACACGACCCGCTCACTCCACGGTCCAACCGCACGAAATGAGAACCTCGGAAAATTCGGAATTCGCTGCACCCGTGCCTCTCTCGCTCGCCTCCGTCATCAGCAGCGCTGCCTCTACTCTCAATCTTTCAGGAAATCTATTGACGCCAATCTCGAGTATGCTCGGGCCGGAGCCGAGTGCTCACCCGATACCGAGTATACCTTTGAGCTCGTCCAGCACGATGTCCGGACCGTCGAACAATGGAATTTACTCGTCGGACAGCGGGGCCACCATGCTCAGCTCTTTGTTGCCGAGTTTGCCGCCGCTCTCGTCGCCCCACGACGTCTTTCGGCACACTGAAATGCTCCGAGGTATGGGCTACCACGACCCGTCGAGACAACACTTGCGACACCTGGAACGTACAGACGTTTCATAA
Protein Sequence: MIQRFFARYLSENDPKGRNVSDQPTTCPLCGAVLRQSRNLRRHLELLHFGLGNSGKAAAIREKSRKSERLSEPHRSPLPPTTRPAHSTVQPHEMRTSENSEFAAPVPLSLASVISSAASTLNLSGNLLTPISSMLGPEPSAHPIPSIPLSSSSTMSGPSNNGIYSSDSGATMLSSLLPSLPPLSSPHDVFRHTEMLRGMGYHDPSRQHLRHLERTDVS

Sequence clustering based on sequence similarity using MMseqs2