Basic Information

Gene Symbol
Mef2
Assembly
GCA_001266575.1
Location
JTDY01000020.1:202296-213951[-]

Transcription Factor Domain

TF Family
SRF
Domain
SRF domain
PFAM
PF00319
TF Group
Helix-turn-helix
Description
Serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [2], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation [1]. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic α-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel β-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see (IPR002487).
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 1.5e-28 8.6e-25 85.9 0.4 1 48 10 57 10 57 0.99

Sequence Information

Coding Sequence
ATGGGCCGGAAGAAAATACAAATATCCCGGATCACGGACGAACGGAATCGGCAGGTGACGTTCAATAAGCGCAAATTTGGCGTTATGAAAAAGGCATATGAACTCAGCGTCCTCTGCGATTGCGAGATTGCCCTCATCATCTTCAGCTCCAACAACAAACTGTACCAGTATGCTAGCACGGATATGGATAAGGTTCTCCTGAAATATACGGAATACAACGAGCCGCACGAGTCTCTGACGAACCGGAACATCATCGAGGCACTAACGAAGAAAGAGCATAAGAACGGAGTGATGTCACCCGACAGCCCCGAACAAGAGCCCGAGTACAACCTGACCCCCCGCACCGAAGCCAAATACTCCAAGATTGACGAAGAATTCCAGATGATGATGCAAAGGAACCAGTTGAACGGAAGCCGAGTTGGAGTTGGAGTGACCGGGAGTAATTACAACCTGCCAGTGAGCGTACCAGTTGGAAGTTATGATCAATCGTTGTTGCAAGCCAGTCCTCAGATGCATACCTCTATCAGTCCACGGCCATCGTCTTCGGAAACAGATTcagTATACCCAAGCGGCGGAATGCTTGAAATGTCAAACGGCTACCCAGGATCAGGATCTCCCCTCGGCGCTGGATGTACTCCTTCTCCATCACCAGGCCCAGCCCCCTCCCCTCACCGACACCCGCACAAGCACCATGCCCCTCCGCCGCACCACTCGCCCCGACATAATAACCTTCGCGTAGTCATACCTAGCTCGATGCCGCCACCGCAAGACGACCTTTCATACACTGGAGAGACACCACTAAGCTACTCAGGACTTGGCAATTTTGGACCGCAGGACTTCAGCATGAGCTCGGACATGGGGATAGGACTGACGTGGGGCGCGCACCAACTGCAGACGTTACAGCACAACAGCAGCAGCTTGCCAGTCCTGGGCGGGGGAGGGACGCCGCCGCCGTCCGCGTCGCCTAGCAACGTAAAGATCAAAGCAGAGCCTGTTTCGCCTCCTCGTGCTCCGGACCACATGCATCGTGTGCCTCCCGCGCCGCAGCCCGCGCACCTATCTGGAGTCCTCGAT
Protein Sequence
MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSNNKLYQYASTDMDKVLLKYTEYNEPHESLTNRNIIEALTKKEHKNGVMSPDSPEQEPEYNLTPRTEAKYSKIDEEFQMMMQRNQLNGSRVGVGVTGSNYNLPVSVPVGSYDQSLLQASPQMHTSISPRPSSSETDSVYPSGGMLEMSNGYPGSGSPLGAGCTPSPSPGPAPSPHRHPHKHHAPPPHHSPRHNNLRVVIPSSMPPPQDDLSYTGETPLSYSGLGNFGPQDFSMSSDMGIGLTWGAHQLQTLQHNSSSLPVLGGGGTPPPSASPSNVKIKAEPVSPPRAPDHMHRVPPAPQPAHLSGVLD

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00923659; iTF_00279089; iTF_00006259; iTF_01125442; iTF_01281316; iTF_00364903; iTF_00408441; iTF_00832985; iTF_00681626; iTF_00001154; iTF_00321572; iTF_00699147; iTF_00700099; iTF_00703942; iTF_00705992; iTF_00701967; iTF_00702879; iTF_00823876; iTF_00823020; iTF_01502069; iTF_00821805; iTF_00744613; iTF_01538725; iTF_00162791; iTF_01529168; iTF_00715767; iTF_00420519; iTF_00778730; iTF_01202441; iTF_00406730; iTF_00187138; iTF_00407563; iTF_00468151; iTF_00467387; iTF_01317269; iTF_01316330; iTF_00114078; iTF_00837514; iTF_01415819; iTF_00450092; iTF_00752050; iTF_01385732; iTF_00185288; iTF_00186155; iTF_01073591; iTF_01367885; iTF_01248110; iTF_01525998; iTF_01094899; iTF_01332687; iTF_01360594; iTF_00445158; iTF_01166674; iTF_00908823; iTF_00441470; iTF_00636382; iTF_00637631; iTF_00706944; iTF_00198097; iTF_00432178; iTF_00290685; iTF_00787630; iTF_00698293; iTF_00696452; iTF_00113302; iTF_00621976; iTF_01387576; iTF_01386684; iTF_01388446; iTF_01042655; iTF_00836538; iTF_00834613; iTF_00207892; iTF_00208860; iTF_01173254; iTF_00428987; iTF_00947867; iTF_00775996; iTF_00774467; iTF_00638621; iTF_01509584; iTF_00267162; iTF_00659421; iTF_00410262; iTF_01180286; iTF_01179466; iTF_01487678; iTF_00968006; iTF_00994329; iTF_00301153; iTF_00017316; iTF_00302086; iTF_00446122; iTF_01377452; iTF_00383631; iTF_01260081; iTF_00042610; iTF_00784371; iTF_01342196; iTF_00000313; iTF_00041753; iTF_00049883; iTF_01361604; iTF_00404901; iTF_00072140; iTF_01491916; iTF_01363089; iTF_00327058; iTF_00785980; iTF_00157182; iTF_00811008; iTF_00925696;
90% Identity
iTF_01182866;
80% Identity
-