Nio008631.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Nymphalis io
Gene Symbol
Sox14
Assembly
GCA_905147045.1
Location
LR989912.1:11206742-11281604[-]

Transcription Factor Domain

TF Family
HMG
Domain
HMG_box domain
PFAM
PF00505
TF Group
Other Alpha-Helix Group
Description
High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 2.4e-29 2.8e-26 92.2 0.6 1 69 49 117 49 117 0.99

Sequence Information

Coding Sequence
ATGGTACCCCAACAAATTTCGGATGTGCGGTCCCTGACGCCTACTTCAAGTGGGGTCCCGGTGTTTGGATCGCAACTGGTCGACAAAAATTCATCAACGCCATATACTGATGCCACACAGACAAAAAAGAACAATCCAAATCACATTAAGAGGCCAATGAACGCTTTCATGGTATGGTCACAAATAGAACGCAGAAAAATTTGCGAACAAACGCCAGATATGCATAATGCAGAAATTTCCAAAAACTTGGGCAGAGTATGGAAAACATTAAATGATGAAGAAAGGCAGCCCTTCATAGACGAGGCGGAAAGGCTCAGGCAGCTACATATGCGCGAGTATCCCGACTACAAATACAGGCCTCGTAAGAAAACGGCGAAGCCGGCGCAACGGAGTGGCGCTATAACGAAGCAAAAACGTAAACAACGGGCTGACAGCAATAACAACAGAGGAGTATCGAGGAGGCGGACGCGGCCAGTTCCTAGTGTTCCAAGTGTACCTATGGAAACACCCGCCCCTCCACCGCTACCCGCGTCCCCTGCGGGGGCGCCTGATTCCCCTGAATCGGCCTGTTTCTATGATGACAACACGCGGCGTGAGCAGACAGACCTAACGGACCTTTACTCGATCACGGATTTGCTACCATTACCAGCAGATTGTGAGGTCGATCTAGATGCATTGACGGACATGGAGTCCTTCGAGACGGCATCCTCCTCTTCCGGATCGCATTTTGAGTTCTCATGCACGCCGGACGTGTCTGACATGCTAAGCGAAATCGGCGTAGCGGGTGATTGGGACGATCACACGTTCTCGTCGTACCTCACGTCGTCTTAA
Protein Sequence
MVPQQISDVRSLTPTSSGVPVFGSQLVDKNSSTPYTDATQTKKNNPNHIKRPMNAFMVWSQIERRKICEQTPDMHNAEISKNLGRVWKTLNDEERQPFIDEAERLRQLHMREYPDYKYRPRKKTAKPAQRSGAITKQKRKQRADSNNNRGVSRRRTRPVPSVPSVPMETPAPPPLPASPAGAPDSPESACFYDDNTRREQTDLTDLYSITDLLPLPADCEVDLDALTDMESFETASSSSGSHFEFSCTPDVSDMLSEIGVAGDWDDHTFSSYLTSS

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_01080699;
90% Identity
iTF_00642306; iTF_00256903; iTF_00144560; iTF_01078195; iTF_01506325; iTF_01508053; iTF_00824732; iTF_00843519; iTF_01507200; iTF_00468163; iTF_00723947; iTF_01124577; iTF_01071618; iTF_01125454; iTF_01280282; iTF_00408451; iTF_00347460; iTF_00960917; iTF_01502966; iTF_01503870; iTF_00074500; iTF_00382598; iTF_00284528; iTF_00448123; iTF_00034718; iTF_00035648; iTF_00681639; iTF_00682418; iTF_00683351; iTF_01334888; iTF_00075531; iTF_00076522; iTF_01081579; iTF_01279243; iTF_01282275; iTF_01281328; iTF_01333815; iTF_01331569; iTF_00942809; iTF_00279100; iTF_00077469; iTF_00006270; iTF_00752062; iTF_00457220; iTF_00695588; iTF_00985089; iTF_00842661; iTF_00801836; iTF_00461549; iTF_01034578; iTF_00960152; iTF_01033723; iTF_00958653; iTF_00959390; iTF_01079878; iTF_00353063; iTF_01141655; iTF_00774475; iTF_00780234; iTF_00782628; iTF_00775239; iTF_00777992; iTF_00781009; iTF_00778740; iTF_00781814; iTF_00779485; iTF_00795692; iTF_01438917; iTF_00673493; iTF_01437974; iTF_00166905; iTF_00887385; iTF_00970394; iTF_01082430; iTF_00971359; iTF_00277348; iTF_01437033; iTF_00007075; iTF_00761668; iTF_01416772; iTF_01251725; iTF_01083318; iTF_01415831; iTF_01337739; iTF_00323500; iTF_01130014; iTF_01153966; iTF_00025231; iTF_00288038; iTF_01153011; iTF_01359740; iTF_00195152; iTF_00195151; iTF_00420529; iTF_00421345; iTF_00418974; iTF_00419744; iTF_01341266; iTF_01387587; iTF_01386694; iTF_01388458; iTF_01385742; iTF_00430643; iTF_01206538; iTF_01204876; iTF_01202452; iTF_00878840; iTF_01205689; iTF_01203226; iTF_01204026; iTF_00771072; iTF_01193574; iTF_01561991; iTF_00710190; iTF_00874449; iTF_00358546; iTF_00114931; iTF_00357491; iTF_00711003; iTF_00875295; iTF_00876159; iTF_01547540; iTF_00458038; iTF_00796502; iTF_00255894; iTF_00896793; iTF_01021213; iTF_00954447; iTF_00621218; iTF_00212451; iTF_00248068; iTF_00247177; iTF_00723051; iTF_01091919; iTF_00159826; iTF_01181876; iTF_01018549; iTF_01017719; iTF_01151192; iTF_00213433; iTF_00354073; iTF_00953497; iTF_00205105; iTF_00855872; iTF_00840287;
80% Identity
iTF_01506325;