Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0068 2.5e+02 2.4 3.2 11 16 13 18 11 19 0.82

2 4 0.42 1.5e+04 -3.3 0.7 12 14 34 36 31 36 0.52

3 4 4.1e-10 1.5e-05 25.5 2.2 4 21 54 71 52 72 0.87

4 4 0.65 2.3e+04 -3.9 6.9 10 15 84 89 83 90 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0068	2.5e+02	2.4	3.2	11	16	13	18	11	19	0.82
2	4	0.42	1.5e+04	-3.3	0.7	12	14	34	36	31	36	0.52
3	4	4.1e-10	1.5e-05	25.5	2.2	4	21	54	71	52	72	0.87
4	4	0.65	2.3e+04	-3.9	6.9	10	15	84	89	83	90	0.83

Coding Sequence: ATGTCTGACGACGGATCTACGGCTGTAGAGAAGAAGGGACGCGGCCGACCAAAATCCAATGGAACACAAGCAGTAGAGGCCAAAGCCGATTCGAAGAAAAGAGGTAGAGCTCCAGCTGCTACCAGGACTAAGGAATCAACAAAGTCTTCTGATGATGAACAGGCGCCAGTTGCGAAAAGGGGTCGAGGCAGGCCCAAGGGGTCCAAGAAAAAGGCAGCTGCAAAGGGAAAGaGTGCACCAGTAGAAGGTAGGGGACGTGGCCGGCCACGCAAGGACCCTGCACCTCCGAAAAAGGATGCTGCCTCTTCTGAAGAAGAACAAGAcgaagatgatgatgacgagGGATCTGAAGAGCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKSNGTQAVEAKADSKKRGRAPAATRTKESTKSSDDEQAPVAKRGRGRPKGSKKKAAAKGKSAPVEGRGRGRPRKDPAPPKKDAASSEEEQDEDDDDEGSEEQ

Sequence clustering based on sequence similarity using MMseqs2