Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.00086 9.3 7.3 0.2 9 44 9 45 2 49 0.86

2 4 0.00024 2.5 9.1 0.4 21 44 50 73 45 77 0.84

3 4 0.00086 9.2 7.3 0.1 21 51 78 108 70 109 0.82

4 4 2.5e-05 0.27 12.2 0.2 21 45 106 130 102 134 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.00086	9.3	7.3	0.2	9	44	9	45	2	49	0.86
2	4	0.00024	2.5	9.1	0.4	21	44	50	73	45	77	0.84
3	4	0.00086	9.2	7.3	0.1	21	51	78	108	70	109	0.82
4	4	2.5e-05	0.27	12.2	0.2	21	45	106	130	102	134	0.90

Coding Sequence: ATGTCTGCAGGAAAGACCTACGCTCGTCCAAGTACCCTGAAAACACATTTACGCACTCATTCTGGTGAAAAACCGTATCGATGCGCCGACTGTAACAAGAGCTTTTCACAAGCGGCTAATTTAACTGCGCATGTGCGAACACACAGTGGCGAAAAACCGTTCCGTTGTCCCATTTGCGACAGACGTTTCTCTCAATCAAGCTCTGTGACAACACACATGCGTACGCACAGTGGGGAACGACCGTATCGATGTCGCATGTGCAAAAAGGCGTTCTCGGATAGTTCGACACTCACCAAGCATCTAAGAATACACAGCGGAGAGAAGCCATACCAATGCAAATTGTGCCTTTTGCGCTTTTCGCAATCGGGCAATTTGAATCGACACATGCGAGTACATGGCACTAATAATACAACAGCTATGATTGGATGA
Protein Sequence: MSAGKTYARPSTLKTHLRTHSGEKPYRCADCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCRMCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHGTNNTTAMIG

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01050638; iTF_00647475; iTF_01022668; iTF_01287510; iTF_01124055; iTF_01022461; iTF_01295476;
90% Identity: iTF_01448757;
80% Identity: iTF_01050638;