Basic Information

Transcription Factor Domain

TF Family: PC4
Domain: PC4 domain
PFAM: PF02229
TF Group: Unclassified Structure
Description: This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.38 1.3e+04 -3.3 0.5 30 37 20 27 18 27 0.81

2 3 0.041 1.4e+03 -0.2 2.2 27 37 36 47 33 47 0.82

3 3 3e-26 1.1e-21 77.0 1.0 1 52 60 112 60 112 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.38	1.3e+04	-3.3	0.5	30	37	20	27	18	27	0.81
2	3	0.041	1.4e+03	-0.2	2.2	27	37	36	47	33	47	0.82
3	3	3e-26	1.1e-21	77.0	1.0	1	52	60	112	60	112	0.97

Coding Sequence: ATGCCGAAATCTAAAGAGTATCTTTCTAGTGATGATTCTAGTGGATCTAGTCACTCTgaagaAGAAAAGCCAAAAAAGAAGAAGCCAAAgcgtgaagaaaaaaaagaaaagaatgcAAAAGAAGAAAAGCCATCAAAAAAGGCATCTTCCAGTAAACTTGATGAAGAAGAACCAACATGGGAAATTGGTAACAAGAAACACGTGACTGTTCGTAAGTGGAAAGGCAAATTGTACATCGACATCCGTGAAATGTATCTTGATAATGAAGGTTCTCTTAAACCTGGACGTAAaggAATTTCATTAACTCCCGAGAACTACATGAAACTTAAAGACATCATGGGAGAAGTAGATGAAGCCGTCAAACTCAAGGCATAA
Protein Sequence: MPKSKEYLSSDDSSGSSHSEEEKPKKKKPKREEKKEKNAKEEKPSKKASSSKLDEEEPTWEIGNKKHVTVRKWKGKLYIDIREMYLDNEGSLKPGRKGISLTPENYMKLKDIMGEVDEAVKLKA

Sequence clustering based on sequence similarity using MMseqs2