Mmed023969.1
Basic Information
- Insect
- Microplitis mediator
- Gene Symbol
- SUB1_1
- Assembly
- GCA_029852145.1
- Location
- CM056853.1:3314887-3317444[-]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 0.38 1.3e+04 -3.3 0.5 30 37 20 27 18 27 0.81 2 3 0.041 1.4e+03 -0.2 2.2 27 37 36 47 33 47 0.82 3 3 3e-26 1.1e-21 77.0 1.0 1 52 60 112 60 112 0.97
Sequence Information
- Coding Sequence
- ATGCCGAAATCTAAAGAGTATCTTTCTAGTGATGATTCTAGTGGATCTAGTCACTCTgaagaAGAAAAGCCAAAAAAGAAGAAGCCAAAgcgtgaagaaaaaaaagaaaagaatgcAAAAGAAGAAAAGCCATCAAAAAAGGCATCTTCCAGTAAACTTGATGAAGAAGAACCAACATGGGAAATTGGTAACAAGAAACACGTGACTGTTCGTAAGTGGAAAGGCAAATTGTACATCGACATCCGTGAAATGTATCTTGATAATGAAGGTTCTCTTAAACCTGGACGTAAaggAATTTCATTAACTCCCGAGAACTACATGAAACTTAAAGACATCATGGGAGAAGTAGATGAAGCCGTCAAACTCAAGGCATAA
- Protein Sequence
- MPKSKEYLSSDDSSGSSHSEEEKPKKKKPKREEKKEKNAKEEKPSKKASSSKLDEEEPTWEIGNKKHVTVRKWKGKLYIDIREMYLDNEGSLKPGRKGISLTPENYMKLKDIMGEVDEAVKLKA
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01005097;
- 90% Identity
- iTF_01005097;
- 80% Identity
- -