Basic Information

Transcription Factor Domain

TF Family: PC4
Domain: PC4 domain
PFAM: PF02229
TF Group: Unclassified Structure
Description: This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.27 1.1e+04 -2.8 0.5 30 37 20 27 17 27 0.79

2 3 0.022 8.6e+02 0.6 1.9 28 37 36 47 31 47 0.80

3 3 3e-26 1.2e-21 77.0 1.0 1 52 60 112 60 112 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.27	1.1e+04	-2.8	0.5	30	37	20	27	17	27	0.79
2	3	0.022	8.6e+02	0.6	1.9	28	37	36	47	31	47	0.80
3	3	3e-26	1.2e-21	77.0	1.0	1	52	60	112	60	112	0.97

Coding Sequence: ATGCCGAAATCTAAAGAATATCTTTCTAGTGATGATTCCAGTGGATCTGATCACTCTGAAgaagaAAAGCCAAAAAAGAAGAAGCCAAAgcgtgaagaaaaaaaagataaagatGTAAAAGAAGAGAAACCATCAAAGAAGGCATCTTCAAGTAAACTTGAAGAAGAAGAACCAACATGGGAAATTGGTAACAAGAAACACGTTACTGTTCGTAAATGGAAAGGAAAATTGTACATCGACATTCGTGAAATGTATCTTGATAATGAAGGTTCTCTTAAACCTGGTCGCAAAggAATTTCTCTAACTCCCGAGAACTACATGAAGCTTAAAGACATCATGGGAGAAGTTGATGAAGCCGTCAAACTCAAGGCATAA
Protein Sequence: MPKSKEYLSSDDSSGSDHSEEEKPKKKKPKREEKKDKDVKEEKPSKKASSSKLEEEEPTWEIGNKKHVTVRKWKGKLYIDIREMYLDNEGSLKPGRKGISLTPENYMKLKDIMGEVDEAVKLKA

Sequence clustering based on sequence similarity using MMseqs2