Mvio016176.1
Basic Information
- Insect
- Metallyticus violacea
- Gene Symbol
- -
- Assembly
- GCA_030762175.1
- Location
- CM060834.1:4418495-4434085[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 2.6 2e+03 0.8 0.0 36 52 115 131 113 133 0.80 2 5 1.7 1.3e+03 1.4 0.1 22 47 129 154 126 159 0.78 3 5 0.00044 0.34 12.9 0.0 22 51 157 186 153 188 0.85 4 5 0.0017 1.3 11.0 0.1 22 50 185 213 182 216 0.84 5 5 0.11 86 5.2 0.0 22 45 213 236 210 241 0.88
Sequence Information
- Coding Sequence
- ATGGATATCAAtttagagattaaagaagaaccaaAGGACTCTGGTACATACCTATATGAATTAGAACAACCAGAAACCAAGgaggaaattacttttattgcgGCTGATGGTATTGCTTTTAAGGATGAGTTAGAGTTTCAGAAGATGATAAGTGAATGCAAATTAAATGCCAAAGTGGAGATTGAAGAAGATCCACTTAACTGTGATGCACATTTAATTGATTTGAAACCAGCAACCAAGGAAGAAAATTCATACATTCTTGAGgagCAGGAAGAGTTTGTTAGAGATTCCATGATGAAGATTAAAGTTGAGGAAAAAGGTTTTCCAACCTATGATGCAGGCCAGTCATCTAATTTAAAGGCTCATCTTTTGAtccatgaaggtaagaaaccacataaatgtgaaatatgtgggaAAAGCTTTAGCAGGTTATCAAGTAtgaggactcatcttttgattcatgagggtaagaaaccacataaatgcgaagtttgtgggaaaaactttagacagtcatataatttaaagactcatcttttgattcatgagggtaagaaaccatataaatgtgaaatttgtggaagaAACTTTAGCCAGTCATCTAATTTAAGGactcatattttaattcatgagggtaaaaaaccacataaatgtgaagtttgtgggaagagctttagcCAGGCATCTAAACTGAGGACTCATCTTCTGGTACATGAagTTTCACTAAATGCAATAGAAGAGTTACACAACAACGTTGTGCAGAATAGTTCTGACAGCGATGGCAACCTCAGCTCACATTTGCAACTGTATACAGGTGACTGCAAGAAACGGGGTCCTTTACTGTTAGTGTACGAGAAACTGGCCGAGAGAGGAATGTCAGAATGCCAATCTTGA
- Protein Sequence
- MDINLEIKEEPKDSGTYLYELEQPETKEEITFIAADGIAFKDELEFQKMISECKLNAKVEIEEDPLNCDAHLIDLKPATKEENSYILEEQEEFVRDSMMKIKVEEKGFPTYDAGQSSNLKAHLLIHEGKKPHKCEICGKSFSRLSSMRTHLLIHEGKKPHKCEVCGKNFRQSYNLKTHLLIHEGKKPYKCEICGRNFSQSSNLRTHILIHEGKKPHKCEVCGKSFSQASKLRTHLLVHEVSLNAIEELHNNVVQNSSDSDGNLSSHLQLYTGDCKKRGPLLLVYEKLAERGMSECQS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00995393;
- 90% Identity
- iTF_00995393;
- 80% Identity
- iTF_00995393;