Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.17 2.9e+02 3.4 0.1 30 39 114 123 109 133 0.72

2 6 0.0037 6.3 8.7 5.0 1 39 117 151 117 161 0.80

3 6 0.014 23 6.9 1.0 18 39 161 179 152 185 0.86

4 6 0.00013 0.22 13.4 1.0 17 39 188 207 180 217 0.82

5 6 0.026 44 6.0 0.5 18 39 217 235 208 241 0.86

6 6 5.6 9.6e+03 -1.5 0.0 34 40 262 268 255 270 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.17	2.9e+02	3.4	0.1	30	39	114	123	109	133	0.72
2	6	0.0037	6.3	8.7	5.0	1	39	117	151	117	161	0.80
3	6	0.014	23	6.9	1.0	18	39	161	179	152	185	0.86
4	6	0.00013	0.22	13.4	1.0	17	39	188	207	180	217	0.82
5	6	0.026	44	6.0	0.5	18	39	217	235	208	241	0.86
6	6	5.6	9.6e+03	-1.5	0.0	34	40	262	268	255	270	0.87

Coding Sequence: ATGGATATCAAtttagagattaaagaagaaccaaAGGACTCTGGTACATACCTATATGAATTAGAACAACCAGAAACCAAGgaggaaattacttttattgcgGCTGATGGTATTGCTTTTAAGGATGAGTTAGAGTTTCAGAAGATGATAAGTGAATGCAAATTAAATGCCAAAGTGGAGATTGAAGAAGATCCACTTAACTGTGATGCACATTTAATTGATTTGAAACCAGCAACCAAGGAAGAAAATTCATACATTCTTGAGgagCAGGAAGAGTTTGTTAGAGATTCCATGATGAAGATTAAAGTTGAGGAAAAAGGTTTTCCAACCTATGATGCAGGCCAGTCATCTAATTTAAAGGCTCATCTTTTGAtccatgaaggtaagaaaccacataaatgtgaaatatgtgggaAAAGCTTTAGCAGGTTATCAAGTAtgaggactcatcttttgattcatgagggtaagaaaccacataaatgcgaagtttgtgggaaaaactttagacagtcatataatttaaagactcatcttttgattcatgagggtaagaaaccatataaatgtgaaatttgtggaagaAACTTTAGCCAGTCATCTAATTTAAGGactcatattttaattcatgagggtaaaaaaccacataaatgtgaagtttgtgggaagagctttagcCAGGCATCTAAACTGAGGACTCATCTTCTGGTACATGAagTTTCACTAAATGCAATAGAAGAGTTACACAACAACGTTGTGCAGAATAGTTCTGACAGCGATGGCAACCTCAGCTCACATTTGCAACTGTATACAGGTGACTGCAAGAAACGGGGTCCTTTACTGTTAGTGTACGAGAAACTGGCCGAGAGAGGAATGTCAGAATGCCAATCTTGA
Protein Sequence: MDINLEIKEEPKDSGTYLYELEQPETKEEITFIAADGIAFKDELEFQKMISECKLNAKVEIEEDPLNCDAHLIDLKPATKEENSYILEEQEEFVRDSMMKIKVEEKGFPTYDAGQSSNLKAHLLIHEGKKPHKCEICGKSFSRLSSMRTHLLIHEGKKPHKCEVCGKNFRQSYNLKTHLLIHEGKKPYKCEICGRNFSQSSNLRTHILIHEGKKPHKCEVCGKSFSQASKLRTHLLVHEVSLNAIEELHNNVVQNSSDSDGNLSSHLQLYTGDCKKRGPLLLVYEKLAERGMSECQS

Sequence clustering based on sequence similarity using MMseqs2