Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.003 2.3 10.2 0.1 20 48 3 31 1 36 0.85

2 9 0.35 2.7e+02 3.6 0.1 22 44 33 55 30 63 0.86

3 9 1.7 1.3e+03 1.4 0.0 24 45 63 84 58 89 0.85

4 9 0.21 1.6e+02 4.3 0.1 20 45 87 112 84 119 0.82

5 9 0.43 3.3e+02 3.3 0.0 22 51 117 146 113 148 0.83

6 9 0.53 4e+02 3.0 0.0 22 52 145 175 142 177 0.85

7 9 3.6 2.7e+03 0.4 0.0 22 47 173 198 169 203 0.77

8 9 0.0034 2.6 10.0 0.1 22 46 201 225 197 231 0.87

9 9 2.9 2.2e+03 0.7 0.0 22 44 257 279 249 283 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.003	2.3	10.2	0.1	20	48	3	31	1	36	0.85
2	9	0.35	2.7e+02	3.6	0.1	22	44	33	55	30	63	0.86
3	9	1.7	1.3e+03	1.4	0.0	24	45	63	84	58	89	0.85
4	9	0.21	1.6e+02	4.3	0.1	20	45	87	112	84	119	0.82
5	9	0.43	3.3e+02	3.3	0.0	22	51	117	146	113	148	0.83
6	9	0.53	4e+02	3.0	0.0	22	52	145	175	142	177	0.85
7	9	3.6	2.7e+03	0.4	0.0	22	47	173	198	169	203	0.77
8	9	0.0034	2.6	10.0	0.1	22	46	201	225	197	231	0.87
9	9	2.9	2.2e+03	0.7	0.0	22	44	257	279	249	283	0.84

Coding Sequence: ATGCCTCAAGTCAacaagccacataaatgtgatatttgtgAAAAAAGCTTTACCAGATCGTTTAATTTAAgggaacatattttgattcatgggaataagaaaccacataaatgtgaagtatgtgggaAGAGGTTTAGCCGAACATCTAATTTAAgagaacatattttgattcatgaaggtaagttACCAGATAAATGTAACGTTTGTGGGGAAAGCTTCACCCTTGCATCTAGCTtgaagagacatcttttgattcatcagggtaaaaaaccacataaatgtgaagtttgtgggaagaggtTTCTGAGGGCATCTAATTTAAGGGAACATCACTTGATTCATGAGggaaagaaaccacataaatgtgaagtttgtggggaGAGCTTTACTCTTGCTTCTAGTTTGAAGAGGCaccttttaattcatgagggtaaaaagccacataaatgtgaagtttgtggggaGAGCTTTACCAATTCATCTACATTGAAGAGCCATCtgttgattcatgagggtaagaaaccacataaatgtgagatatgtgggaagagttttacccaTTTATCTACCTTAAAAAgccatcttttgattcatgagggtaagaaacctcATAAATGTGAGGTTTGTAGGAAGAGTTTTACTCAGGTATCTAACTtaaagagacatcttttgattcatgagggcaagaaatcacataaatgtgaagtttgtggaaagttcTTTACCCTTTTATCTACCTTGAAGAACCATCGTTTGGtccatgaaggtaagaaaccatataaatgtcaagtttgtggaaagagctatACCCGGGCATCTgcattaaagaaacatcttttcatTCATAAGTGA
Protein Sequence: MPQVNKPHKCDICEKSFTRSFNLREHILIHGNKKPHKCEVCGKRFSRTSNLREHILIHEGKLPDKCNVCGESFTLASSLKRHLLIHQGKKPHKCEVCGKRFLRASNLREHHLIHEGKKPHKCEVCGESFTLASSLKRHLLIHEGKKPHKCEVCGESFTNSSTLKSHLLIHEGKKPHKCEICGKSFTHLSTLKSHLLIHEGKKPHKCEVCRKSFTQVSNLKRHLLIHEGKKSHKCEVCGKFFTLLSTLKNHRLVHEGKKPYKCQVCGKSYTRASALKKHLFIHK

Sequence clustering based on sequence similarity using MMseqs2