Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.0032 5.4 8.9 0.4 18 39 9 27 4 37 0.82

2 10 6.2e-05 0.11 14.4 0.5 18 39 37 55 32 59 0.92

3 10 0.047 81 5.2 0.9 18 39 65 83 64 93 0.81

4 10 0.15 2.6e+02 3.5 3.5 3 38 79 110 77 115 0.78

5 10 0.24 4.1e+02 2.9 1.4 18 39 121 139 111 149 0.80

6 10 0.0082 14 7.6 3.2 3 39 135 167 133 177 0.76

7 10 0.033 56 5.7 3.4 18 39 177 195 169 205 0.82

8 10 0.017 30 6.6 8.1 4 43 192 232 189 234 0.76

9 10 0.79 1.3e+03 1.2 1.4 14 28 229 243 224 255 0.75

10 10 0.0027 4.7 9.1 1.4 16 39 259 279 245 283 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.0032	5.4	8.9	0.4	18	39	9	27	4	37	0.82
2	10	6.2e-05	0.11	14.4	0.5	18	39	37	55	32	59	0.92
3	10	0.047	81	5.2	0.9	18	39	65	83	64	93	0.81
4	10	0.15	2.6e+02	3.5	3.5	3	38	79	110	77	115	0.78
5	10	0.24	4.1e+02	2.9	1.4	18	39	121	139	111	149	0.80
6	10	0.0082	14	7.6	3.2	3	39	135	167	133	177	0.76
7	10	0.033	56	5.7	3.4	18	39	177	195	169	205	0.82
8	10	0.017	30	6.6	8.1	4	43	192	232	189	234	0.76
9	10	0.79	1.3e+03	1.2	1.4	14	28	229	243	224	255	0.75
10	10	0.0027	4.7	9.1	1.4	16	39	259	279	245	283	0.82

Coding Sequence: ATGCCTCAAGTCAacaagccacataaatgtgatatttgtgAAAAAAGCTTTACCAGATCGTTTAATTTAAgggaacatattttgattcatgggaataagaaaccacataaatgtgaagtatgtgggaAGAGGTTTAGCCGAACATCTAATTTAAgagaacatattttgattcatgaaggtaagttACCAGATAAATGTAACGTTTGTGGGGAAAGCTTCACCCTTGCATCTAGCTtgaagagacatcttttgattcatcagggtaaaaaaccacataaatgtgaagtttgtgggaagaggtTTCTGAGGGCATCTAATTTAAGGGAACATCACTTGATTCATGAGggaaagaaaccacataaatgtgaagtttgtggggaGAGCTTTACTCTTGCTTCTAGTTTGAAGAGGCaccttttaattcatgagggtaaaaagccacataaatgtgaagtttgtggggaGAGCTTTACCAATTCATCTACATTGAAGAGCCATCtgttgattcatgagggtaagaaaccacataaatgtgagatatgtgggaagagttttacccaTTTATCTACCTTAAAAAgccatcttttgattcatgagggtaagaaacctcATAAATGTGAGGTTTGTAGGAAGAGTTTTACTCAGGTATCTAACTtaaagagacatcttttgattcatgagggcaagaaatcacataaatgtgaagtttgtggaaagttcTTTACCCTTTTATCTACCTTGAAGAACCATCGTTTGGtccatgaaggtaagaaaccatataaatgtcaagtttgtggaaagagctatACCCGGGCATCTgcattaaagaaacatcttttcatTCATAAGTGA
Protein Sequence: MPQVNKPHKCDICEKSFTRSFNLREHILIHGNKKPHKCEVCGKRFSRTSNLREHILIHEGKLPDKCNVCGESFTLASSLKRHLLIHQGKKPHKCEVCGKRFLRASNLREHHLIHEGKKPHKCEVCGESFTLASSLKRHLLIHEGKKPHKCEVCGESFTNSSTLKSHLLIHEGKKPHKCEICGKSFTHLSTLKSHLLIHEGKKPHKCEVCRKSFTQVSNLKRHLLIHEGKKSHKCEVCGKFFTLLSTLKNHRLVHEGKKPYKCQVCGKSYTRASALKKHLFIHK

Sequence clustering based on sequence similarity using MMseqs2