Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.55 4.2e+02 2.9 0.1 27 51 75 98 61 100 0.77

2 8 0.018 14 7.7 0.0 22 47 97 122 93 127 0.84

3 8 0.63 4.8e+02 2.8 0.0 22 48 125 151 122 155 0.82

4 8 0.0089 6.8 8.7 0.1 22 45 153 176 150 183 0.84

5 8 0.09 69 5.5 0.1 22 46 181 205 177 212 0.87

6 8 0.17 1.3e+02 4.6 0.1 26 46 213 233 207 239 0.86

7 8 0.031 24 7.0 0.1 26 50 241 265 234 268 0.83

8 8 0.7 5.3e+02 2.6 0.1 22 45 265 288 262 293 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.55	4.2e+02	2.9	0.1	27	51	75	98	61	100	0.77
2	8	0.018	14	7.7	0.0	22	47	97	122	93	127	0.84
3	8	0.63	4.8e+02	2.8	0.0	22	48	125	151	122	155	0.82
4	8	0.0089	6.8	8.7	0.1	22	45	153	176	150	183	0.84
5	8	0.09	69	5.5	0.1	22	46	181	205	177	212	0.87
6	8	0.17	1.3e+02	4.6	0.1	26	46	213	233	207	239	0.86
7	8	0.031	24	7.0	0.1	26	50	241	265	234	268	0.83
8	8	0.7	5.3e+02	2.6	0.1	22	45	265	288	262	293	0.87

Coding Sequence: ATGACAGAACAATCTTGGGGTGATAAGACCTGTACACGTTGCAGGTGGTATGGGTACAATTGCTGGTCTTTCAGCTGTCTCCAGACATCTGCATTGCTAATCCGCAACATTGAGGATAGGGACTGTTCACATCAGGGATTTTGTGGCCATCCTCTGTCTGCAGCTGCAGGCATGAAGCTTCCATGTTCACACAGATGGTATGAGAGGAAGAAGTTGTATAAGTGCacagtttgtgggaagagcttcaagtcatctaatttaagggaacatcttttgattcatgagggtaagaaaccacataaatgtgaggtttgtgggaagagcttcaCCAAGTCATCTAATTTAAGGGAACACattttgatacatgagggtaaaaaaccatataaatgtgaagtttgtggcaagaACTTTACCCGGGCATCTAATTTAAAGTTGCATCtcttgattcatgagggtaagaaaccacataaatgtgaagtttgtagcAAGAGCATTAGCCAGACATCTACCTTGAGGTCACATCTTTTAactcatgagggtaagaaaccacataaatgtgaagtttgtaacAAGAGTTTTACCCAAGTATCTACGTTGAacagacatcttttgattcatgagggtaagaaacaacataaatgtaaaatatgtagcaAAAGCTTTACACAGGCATCTACCTTGAggtcacatcttttgattcacgagggtaagaaacaacataaatgtGATATTTGTAGTAAGAGCTTTACTCAGGCATCTACACTGAAGAGACATCTTTTggttcatgagggcaagaagccacataaatgtgaagtttgtagcAAGAGCTTTACTCTGGCATCTGCCTtgaagagacatcttttgattcatgagggcaagaaataA
Protein Sequence: MTEQSWGDKTCTRCRWYGYNCWSFSCLQTSALLIRNIEDRDCSHQGFCGHPLSAAAGMKLPCSHRWYERKKLYKCTVCGKSFKSSNLREHLLIHEGKKPHKCEVCGKSFTKSSNLREHILIHEGKKPYKCEVCGKNFTRASNLKLHLLIHEGKKPHKCEVCSKSISQTSTLRSHLLTHEGKKPHKCEVCNKSFTQVSTLNRHLLIHEGKKQHKCKICSKSFTQASTLRSHLLIHEGKKQHKCDICSKSFTQASTLKRHLLVHEGKKPHKCEVCSKSFTLASALKRHLLIHEGKK

Sequence clustering based on sequence similarity using MMseqs2