Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.002 3.5 9.5 1.9 13 39 69 91 60 101 0.81

2 8 0.0027 4.7 9.1 0.8 18 39 101 119 92 125 0.89

3 8 0.00084 1.4 10.7 1.2 17 39 128 147 120 157 0.81

4 8 0.0098 17 7.3 5.4 14 39 153 175 141 185 0.75

5 8 0.0085 14 7.5 2.2 18 44 185 213 178 213 0.89

6 8 0.0018 3 9.7 1.9 17 44 212 241 207 241 0.86

7 8 0.0078 13 7.7 1.9 16 39 239 259 232 269 0.80

8 8 0.31 5.3e+02 2.5 0.8 18 39 269 287 260 291 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.002	3.5	9.5	1.9	13	39	69	91	60	101	0.81
2	8	0.0027	4.7	9.1	0.8	18	39	101	119	92	125	0.89
3	8	0.00084	1.4	10.7	1.2	17	39	128	147	120	157	0.81
4	8	0.0098	17	7.3	5.4	14	39	153	175	141	185	0.75
5	8	0.0085	14	7.5	2.2	18	44	185	213	178	213	0.89
6	8	0.0018	3	9.7	1.9	17	44	212	241	207	241	0.86
7	8	0.0078	13	7.7	1.9	16	39	239	259	232	269	0.80
8	8	0.31	5.3e+02	2.5	0.8	18	39	269	287	260	291	0.87

Coding Sequence: ATGACAGAACAATCTTGGGGTGATAAGACCTGTACACGTTGCAGGTGGTATGGGTACAATTGCTGGTCTTTCAGCTGTCTCCAGACATCTGCATTGCTAATCCGCAACATTGAGGATAGGGACTGTTCACATCAGGGATTTTGTGGCCATCCTCTGTCTGCAGCTGCAGGCATGAAGCTTCCATGTTCACACAGATGGTATGAGAGGAAGAAGTTGTATAAGTGCacagtttgtgggaagagcttcaagtcatctaatttaagggaacatcttttgattcatgagggtaagaaaccacataaatgtgaggtttgtgggaagagcttcaCCAAGTCATCTAATTTAAGGGAACACattttgatacatgagggtaaaaaaccatataaatgtgaagtttgtggcaagaACTTTACCCGGGCATCTAATTTAAAGTTGCATCtcttgattcatgagggtaagaaaccacataaatgtgaagtttgtagcAAGAGCATTAGCCAGACATCTACCTTGAGGTCACATCTTTTAactcatgagggtaagaaaccacataaatgtgaagtttgtaacAAGAGTTTTACCCAAGTATCTACGTTGAacagacatcttttgattcatgagggtaagaaacaacataaatgtaaaatatgtagcaAAAGCTTTACACAGGCATCTACCTTGAggtcacatcttttgattcacgagggtaagaaacaacataaatgtGATATTTGTAGTAAGAGCTTTACTCAGGCATCTACACTGAAGAGACATCTTTTggttcatgagggcaagaagccacataaatgtgaagtttgtagcAAGAGCTTTACTCTGGCATCTGCCTtgaagagacatcttttgattcatgagggcaagaaataA
Protein Sequence: MTEQSWGDKTCTRCRWYGYNCWSFSCLQTSALLIRNIEDRDCSHQGFCGHPLSAAAGMKLPCSHRWYERKKLYKCTVCGKSFKSSNLREHLLIHEGKKPHKCEVCGKSFTKSSNLREHILIHEGKKPYKCEVCGKNFTRASNLKLHLLIHEGKKPHKCEVCSKSISQTSTLRSHLLTHEGKKPHKCEVCNKSFTQVSTLNRHLLIHEGKKQHKCKICSKSFTQASTLRSHLLIHEGKKQHKCDICSKSFTQASTLKRHLLVHEGKKPHKCEVCSKSFTLASALKRHLLIHEGKK

Sequence clustering based on sequence similarity using MMseqs2