Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 0.064 49 6.0 0.2 22 51 25 61 20 63 0.74

2 11 0.02 15 7.6 0.0 22 51 60 89 57 91 0.85

3 11 0.0011 0.87 11.5 0.1 22 52 88 118 85 119 0.86

4 11 0.67 5.1e+02 2.7 0.1 22 49 116 142 113 146 0.81

5 11 5.7 4.3e+03 -0.3 0.1 26 46 148 168 144 175 0.69

6 11 0.38 2.9e+02 3.5 0.1 22 52 172 202 168 204 0.85

7 11 0.088 67 5.5 0.1 23 44 201 222 197 230 0.84

8 11 0.00076 0.58 12.1 0.3 22 52 228 258 222 260 0.85

9 11 0.37 2.8e+02 3.5 0.0 22 48 256 282 253 287 0.83

10 11 0.38 2.9e+02 3.5 0.1 22 48 284 310 281 314 0.81

11 11 0.029 22 7.1 0.0 22 44 312 334 308 337 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	0.064	49	6.0	0.2	22	51	25	61	20	63	0.74
2	11	0.02	15	7.6	0.0	22	51	60	89	57	91	0.85
3	11	0.0011	0.87	11.5	0.1	22	52	88	118	85	119	0.86
4	11	0.67	5.1e+02	2.7	0.1	22	49	116	142	113	146	0.81
5	11	5.7	4.3e+03	-0.3	0.1	26	46	148	168	144	175	0.69
6	11	0.38	2.9e+02	3.5	0.1	22	52	172	202	168	204	0.85
7	11	0.088	67	5.5	0.1	23	44	201	222	197	230	0.84
8	11	0.00076	0.58	12.1	0.3	22	52	228	258	222	260	0.85
9	11	0.37	2.8e+02	3.5	0.0	22	48	256	282	253	287	0.83
10	11	0.38	2.9e+02	3.5	0.1	22	48	284	310	281	314	0.81
11	11	0.029	22	7.1	0.0	22	44	312	334	308	337	0.89

Coding Sequence: ATGTGCAATGCGGTAAAAGAAAGTCATGAAGAAGTATGTCCATCCCCTCCCGTCTGCGTGAACTGCGGCGGAGACCATCCTGCTTCGTGTCCTGACTGTCCTGAGAAGAACTCTGTACACAGGAAGAGCTTTACCAAGACATCTAATTTAaggcaacatcttttgattcatgagggtaagaaaccacataaatgtgaagtttgtggcaagagTTTTAGGCGGACATCTAATTTAAAGAtgcatcttttgatacatgagggtaagaaaccacataaatgtgaagtttgtggtaagagctttagGCGGACATCTAATTtaaagagacatcttttgattcatgaggataaCAAACCCCATAAATGTGAATATTGTGGGAATAGCTTTACCCGGACATCTAcgttaaggaaacatcttttgattcattggattaagaaacaacataaatgtaaagtttgtgggaagagctttatccgTAAGTCTTatttaaggacacatcttttgaCTCATGAGGGTaacaaaccacataaatgtgaatattGTGGGAATAGCTTTACCCGGACATCtactttaaggaaacatcttttgattcatggggttaagaaaccacataaatgtgaagtttgtgggaataGCTTTACTCAAACATTTACTTTAAGGAGACATcgtttgattcatgagggtaagaaaccacataaatgtgtagtttgtggtaagagctttgTGCAGTCATGTAATTtaaagagacatcttttgattcatgagggtaagaagcctcataaatgtgaagtttgtggtaagagctttatGGATACATCTCATTTAAAGAGACATCTTTTgtttcatgaaggtaagaaaccacataaatgtgaagtttgtgggaagagctttaccttGATATCtactttaaggagacatcttttgattcatgagggtaagaaaccacttaaatgtgaagtttgtgggaaggtCTTTACCCAAGCATCTAATTTAACGGTACATCTTTTGATCCATTAG
Protein Sequence: MCNAVKESHEEVCPSPPVCVNCGGDHPASCPDCPEKNSVHRKSFTKTSNLRQHLLIHEGKKPHKCEVCGKSFRRTSNLKMHLLIHEGKKPHKCEVCGKSFRRTSNLKRHLLIHEDNKPHKCEYCGNSFTRTSTLRKHLLIHWIKKQHKCKVCGKSFIRKSYLRTHLLTHEGNKPHKCEYCGNSFTRTSTLRKHLLIHGVKKPHKCEVCGNSFTQTFTLRRHRLIHEGKKPHKCVVCGKSFVQSCNLKRHLLIHEGKKPHKCEVCGKSFMDTSHLKRHLLFHEGKKPHKCEVCGKSFTLISTLRRHLLIHEGKKPLKCEVCGKVFTQASNLTVHLLIH

Sequence clustering based on sequence similarity using MMseqs2