Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.037 28 6.7 0.2 22 51 16 45 13 47 0.85

2 9 0.19 1.4e+02 4.4 0.0 23 52 45 74 42 75 0.85

3 9 0.0012 0.92 11.5 0.0 20 46 70 96 67 102 0.88

4 9 0.0051 3.9 9.5 0.1 23 47 101 125 97 131 0.84

5 9 0.00073 0.56 12.2 0.0 23 51 129 157 127 159 0.85

6 9 4.9 3.7e+03 -0.1 0.0 22 44 156 178 152 185 0.82

7 9 0.17 1.3e+02 4.6 0.0 23 51 185 213 180 215 0.80

8 9 0.012 8.9 8.3 0.3 22 51 212 241 209 243 0.85

9 9 1.4 1.1e+03 1.6 0.4 23 49 241 266 237 271 0.80

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.037	28	6.7	0.2	22	51	16	45	13	47	0.85
2	9	0.19	1.4e+02	4.4	0.0	23	52	45	74	42	75	0.85
3	9	0.0012	0.92	11.5	0.0	20	46	70	96	67	102	0.88
4	9	0.0051	3.9	9.5	0.1	23	47	101	125	97	131	0.84
5	9	0.00073	0.56	12.2	0.0	23	51	129	157	127	159	0.85
6	9	4.9	3.7e+03	-0.1	0.0	22	44	156	178	152	185	0.82
7	9	0.17	1.3e+02	4.6	0.0	23	51	185	213	180	215	0.80
8	9	0.012	8.9	8.3	0.3	22	51	212	241	209	243	0.85
9	9	1.4	1.1e+03	1.6	0.4	23	49	241	266	237	271	0.80

Coding Sequence: atgCAGGTATCACATTTAAGGGATCATCTATTGATTCATGAAGGccagaaaccacataaatgtgaagtttgtgaaaagagctttacccaggcaactcatttaagggaacatctgttaattcatgagggtaggaagccccataaatgtgaagtatgtggaAAGAACTTTACCCAGTCATCTAGTATGAAGACTCATTTGCTGATTCAtcagggtaagaaaccacataaatgtgaagcttGTGGGAAAAGCTTCATCCAGTCATCTAATTTGAGAAAACATCTTCtaattcatgaaggaaagaatccacataaatgtgaaatatgtggaaagagctttacacaGTCATCTTCTTTGAGGACTCATCTTCTGATTCATGGGGGtataaaaccacataaatgtatgGTTTGTGGAAAAAATTTTACCCAATCATCTAATTTAAGGaagcatcttttaattcatgagggtaagaaaccacataaatgtgaagtttgtggaaagagctttacccgcATGTATGATCTGAGGACTCACTTTTTGATACATCAGggtaaaaaacaacataaatgtgaggtttgtggaaagaactttatCCAATCAGGTAATTTAAgtactcatcttttgattcatgagggtaagaaaccacataaatgtgaggtTTGTAGAAAAAGCTTTACTCAGTTATCTAatttaaggacacatcttttgattcatgagggtaggaaaccacataaatgtgcaaTTTGTGAGAAAAGATTTACCCTAGTATCTCATTTGAGATCTCATCTTTTGACACATAAAGCCCAGAACCCTGTTGATGTCCATTTTGTTGGAAGAGCTTTACCATAG
Protein Sequence: MQVSHLRDHLLIHEGQKPHKCEVCEKSFTQATHLREHLLIHEGRKPHKCEVCGKNFTQSSSMKTHLLIHQGKKPHKCEACGKSFIQSSNLRKHLLIHEGKNPHKCEICGKSFTQSSSLRTHLLIHGGIKPHKCMVCGKNFTQSSNLRKHLLIHEGKKPHKCEVCGKSFTRMYDLRTHFLIHQGKKQHKCEVCGKNFIQSGNLSTHLLIHEGKKPHKCEVCRKSFTQLSNLRTHLLIHEGRKPHKCAICEKRFTLVSHLRSHLLTHKAQNPVDVHFVGRALP

Sequence clustering based on sequence similarity using MMseqs2