Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.26 4.5e+02 2.8 2.4 17 40 19 44 4 48 0.76

2 9 0.0055 9.3 8.2 2.4 17 39 47 66 36 76 0.79

3 9 0.0082 14 7.6 1.1 18 39 76 94 68 104 0.85

4 9 0.0028 4.7 9.1 1.2 18 39 104 122 95 132 0.83

5 9 4.9e-05 0.085 14.7 1.7 18 39 132 150 129 160 0.83

6 9 0.13 2.3e+02 3.7 0.9 18 33 160 177 151 181 0.78

7 9 0.0031 5.2 9.0 2.1 6 39 177 206 174 216 0.78

8 9 0.027 46 5.9 2.5 18 41 216 241 208 244 0.81

9 9 0.081 1.4e+02 4.4 2.4 18 39 244 262 240 268 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.26	4.5e+02	2.8	2.4	17	40	19	44	4	48	0.76
2	9	0.0055	9.3	8.2	2.4	17	39	47	66	36	76	0.79
3	9	0.0082	14	7.6	1.1	18	39	76	94	68	104	0.85
4	9	0.0028	4.7	9.1	1.2	18	39	104	122	95	132	0.83
5	9	4.9e-05	0.085	14.7	1.7	18	39	132	150	129	160	0.83
6	9	0.13	2.3e+02	3.7	0.9	18	33	160	177	151	181	0.78
7	9	0.0031	5.2	9.0	2.1	6	39	177	206	174	216	0.78
8	9	0.027	46	5.9	2.5	18	41	216	241	208	244	0.81
9	9	0.081	1.4e+02	4.4	2.4	18	39	244	262	240	268	0.86

Coding Sequence: atgCAGGTATCACATTTAAGGGATCATCTATTGATTCATGAAGGccagaaaccacataaatgtgaagtttgtgaaaagagctttacccaggcaactcatttaagggaacatctgttaattcatgagggtaggaagccccataaatgtgaagtatgtggaAAGAACTTTACCCAGTCATCTAGTATGAAGACTCATTTGCTGATTCAtcagggtaagaaaccacataaatgtgaagcttGTGGGAAAAGCTTCATCCAGTCATCTAATTTGAGAAAACATCTTCtaattcatgaaggaaagaatccacataaatgtgaaatatgtggaaagagctttacacaGTCATCTTCTTTGAGGACTCATCTTCTGATTCATGGGGGtataaaaccacataaatgtatgGTTTGTGGAAAAAATTTTACCCAATCATCTAATTTAAGGaagcatcttttaattcatgagggtaagaaaccacataaatgtgaagtttgtggaaagagctttacccgcATGTATGATCTGAGGACTCACTTTTTGATACATCAGggtaaaaaacaacataaatgtgaggtttgtggaaagaactttatCCAATCAGGTAATTTAAgtactcatcttttgattcatgagggtaagaaaccacataaatgtgaggtTTGTAGAAAAAGCTTTACTCAGTTATCTAatttaaggacacatcttttgattcatgagggtaggaaaccacataaatgtgcaaTTTGTGAGAAAAGATTTACCCTAGTATCTCATTTGAGATCTCATCTTTTGACACATAAAGCCCAGAACCCTGTTGATGTCCATTTTGTTGGAAGAGCTTTACCATAG
Protein Sequence: MQVSHLRDHLLIHEGQKPHKCEVCEKSFTQATHLREHLLIHEGRKPHKCEVCGKNFTQSSSMKTHLLIHQGKKPHKCEACGKSFIQSSNLRKHLLIHEGKNPHKCEICGKSFTQSSSLRTHLLIHGGIKPHKCMVCGKNFTQSSNLRKHLLIHEGKKPHKCEVCGKSFTRMYDLRTHFLIHQGKKQHKCEVCGKNFIQSGNLSTHLLIHEGKKPHKCEVCRKSFTQLSNLRTHLLIHEGRKPHKCAICEKRFTLVSHLRSHLLTHKAQNPVDVHFVGRALP

Sequence clustering based on sequence similarity using MMseqs2