Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.046 35 6.4 0.1 26 52 15 41 8 43 0.86

2 9 0.1 78 5.3 0.0 22 49 39 66 36 70 0.83

3 9 0.00068 0.52 12.3 0.2 22 51 67 96 63 98 0.85

4 9 0.079 60 5.7 0.0 22 45 95 118 92 124 0.88

5 9 0.0058 4.5 9.3 0.1 22 46 151 175 148 181 0.86

6 9 0.089 68 5.5 0.0 22 48 179 205 176 209 0.84

7 9 0.0038 2.9 9.9 0.0 22 51 207 236 203 238 0.85

8 9 0.13 97 5.0 0.1 22 45 235 258 232 266 0.87

9 9 0.072 55 5.8 0.3 25 45 266 286 259 289 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.046	35	6.4	0.1	26	52	15	41	8	43	0.86
2	9	0.1	78	5.3	0.0	22	49	39	66	36	70	0.83
3	9	0.00068	0.52	12.3	0.2	22	51	67	96	63	98	0.85
4	9	0.079	60	5.7	0.0	22	45	95	118	92	124	0.88
5	9	0.0058	4.5	9.3	0.1	22	46	151	175	148	181	0.86
6	9	0.089	68	5.5	0.0	22	48	179	205	176	209	0.84
7	9	0.0038	2.9	9.9	0.0	22	51	207	236	203	238	0.85
8	9	0.13	97	5.0	0.1	22	45	235	258	232	266	0.87
9	9	0.072	55	5.8	0.3	25	45	266	286	259	289	0.83

Coding Sequence: ATGATAAATGAGTGTTGTTTAAAAAGCCATAAAAAGGCACATAAGTGTGAcatttgtgagaagagctttgcCTGGGCATCTACTTTAagaagacatcttttgattcacaaggttaagaagccacataaatgtgaaatttgtgataagagtTTTGCATGGGCATCTAATTTAAGGGAACATGTTttaattcatgaaggtaagaagccacatcagtgtgaagtttgtgggaagagctttacccagtcatctcatttaaggagacatcttttaattcatgagggtaagaagccacataaatgtgaagtttgtgagaagagctttacccacTCAGAtactttaaggaaacatcttttgattcatgagggtaagaggatatataaatgtgaagtttgtgggaagagctttactcgaGCATCTGGTTTAAAGGTACACCTTTTGATTCACgatggtaagaaaccacataaatgtgaagtttgtgagaagagctttacccaggcatctagtttaagaagacatcttttgattcctgagggtaagaaaccacataaatgtgaaatttgtgggaagagctttacccactCATATACTTTatggagacatcttttgattcatgagggtaagaagccacataaatgtgaaatttgtgggaacaGCTTTACCGATACATCTAATTTAAAGAGACATCTCTTGATTCACGAGGGtaaaaagccacataaatgtgaagtttgtaagAAAAACTTTACCCAGGCTGTTCATTTAAggtcacatcttttgattcaccaGGATAAAActgcacataaatgtgaagtttgtggcaagagGTTTGCCCAAGCATCTCaattaaggagacatcttttgattcacaagtaa
Protein Sequence: MINECCLKSHKKAHKCDICEKSFAWASTLRRHLLIHKVKKPHKCEICDKSFAWASNLREHVLIHEGKKPHQCEVCGKSFTQSSHLRRHLLIHEGKKPHKCEVCEKSFTHSDTLRKHLLIHEGKRIYKCEVCGKSFTRASGLKVHLLIHDGKKPHKCEVCEKSFTQASSLRRHLLIPEGKKPHKCEICGKSFTHSYTLWRHLLIHEGKKPHKCEICGNSFTDTSNLKRHLLIHEGKKPHKCEVCKKNFTQAVHLRSHLLIHQDKTAHKCEVCGKRFAQASQLRRHLLIHK

Sequence clustering based on sequence similarity using MMseqs2