Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.0053 9.2 8.2 1.8 14 39 11 33 6 43 0.79

2 10 0.087 1.5e+02 4.3 0.4 18 39 43 61 35 71 0.82

3 10 0.0076 13 7.7 3.2 6 39 60 89 55 99 0.75

4 10 0.072 1.2e+02 4.6 1.3 18 39 99 117 91 124 0.86

5 10 0.0035 6 8.8 1.3 14 39 123 145 115 155 0.75

6 10 0.013 22 7.0 0.3 18 39 155 173 147 183 0.82

7 10 0.0071 12 7.8 2.7 17 39 182 201 173 211 0.79

8 10 6e-06 0.01 17.6 3.1 3 39 197 229 195 239 0.86

9 10 0.51 8.7e+02 1.8 2.9 18 39 239 257 231 266 0.72

10 10 0.0015 2.6 9.9 1.4 6 39 256 285 253 289 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.0053	9.2	8.2	1.8	14	39	11	33	6	43	0.79
2	10	0.087	1.5e+02	4.3	0.4	18	39	43	61	35	71	0.82
3	10	0.0076	13	7.7	3.2	6	39	60	89	55	99	0.75
4	10	0.072	1.2e+02	4.6	1.3	18	39	99	117	91	124	0.86
5	10	0.0035	6	8.8	1.3	14	39	123	145	115	155	0.75
6	10	0.013	22	7.0	0.3	18	39	155	173	147	183	0.82
7	10	0.0071	12	7.8	2.7	17	39	182	201	173	211	0.79
8	10	6e-06	0.01	17.6	3.1	3	39	197	229	195	239	0.86
9	10	0.51	8.7e+02	1.8	2.9	18	39	239	257	231	266	0.72
10	10	0.0015	2.6	9.9	1.4	6	39	256	285	253	289	0.86

Coding Sequence: ATGATAAATGAGTGTTGTTTAAAAAGCCATAAAAAGGCACATAAGTGTGAcatttgtgagaagagctttgcCTGGGCATCTACTTTAagaagacatcttttgattcacaaggttaagaagccacataaatgtgaaatttgtgataagagtTTTGCATGGGCATCTAATTTAAGGGAACATGTTttaattcatgaaggtaagaagccacatcagtgtgaagtttgtgggaagagctttacccagtcatctcatttaaggagacatcttttaattcatgagggtaagaagccacataaatgtgaagtttgtgagaagagctttacccacTCAGAtactttaaggaaacatcttttgattcatgagggtaagaggatatataaatgtgaagtttgtgggaagagctttactcgaGCATCTGGTTTAAAGGTACACCTTTTGATTCACgatggtaagaaaccacataaatgtgaagtttgtgagaagagctttacccaggcatctagtttaagaagacatcttttgattcctgagggtaagaaaccacataaatgtgaaatttgtgggaagagctttacccactCATATACTTTatggagacatcttttgattcatgagggtaagaagccacataaatgtgaaatttgtgggaacaGCTTTACCGATACATCTAATTTAAAGAGACATCTCTTGATTCACGAGGGtaaaaagccacataaatgtgaagtttgtaagAAAAACTTTACCCAGGCTGTTCATTTAAggtcacatcttttgattcaccaGGATAAAActgcacataaatgtgaagtttgtggcaagagGTTTGCCCAAGCATCTCaattaaggagacatcttttgattcacaagtaa
Protein Sequence: MINECCLKSHKKAHKCDICEKSFAWASTLRRHLLIHKVKKPHKCEICDKSFAWASNLREHVLIHEGKKPHQCEVCGKSFTQSSHLRRHLLIHEGKKPHKCEVCEKSFTHSDTLRKHLLIHEGKRIYKCEVCGKSFTRASGLKVHLLIHDGKKPHKCEVCEKSFTQASSLRRHLLIPEGKKPHKCEICGKSFTHSYTLWRHLLIHEGKKPHKCEICGNSFTDTSNLKRHLLIHEGKKPHKCEVCKKNFTQAVHLRSHLLIHQDKTAHKCEVCGKRFAQASQLRRHLLIHK

Sequence clustering based on sequence similarity using MMseqs2