Basic Information

Insect: Metallyticus violacea
Gene Symbol: -
Assembly: GCA_030762175.1
Location: CM060835.1:52156134-52157840[-]

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 20 0.0036 6.2 8.7 0.6 18 39 9 27 5 37 0.83

2 20 0.69 1.2e+03 1.4 1.8 18 28 37 47 29 59 0.82

3 20 0.46 7.9e+02 2.0 1.4 18 39 65 83 54 93 0.82

4 20 4.7 8.1e+03 -1.3 3.5 17 39 92 111 84 117 0.75

5 20 0.014 24 6.8 2.2 14 39 117 139 105 146 0.83

6 20 0.0021 3.7 9.4 0.7 17 39 148 167 141 174 0.88

7 20 0.0016 2.8 9.8 0.6 17 39 176 195 169 205 0.83

8 20 0.0012 2 10.3 0.9 18 39 205 223 197 233 0.83

9 20 0.62 1.1e+03 1.6 2.2 18 39 233 251 224 263 0.79

10 20 3.7 6.3e+03 -0.9 1.5 18 39 261 279 253 289 0.75

11 20 0.034 57 5.6 1.4 9 39 281 307 273 311 0.77

12 20 0.0008 1.4 10.8 0.3 18 40 317 336 314 339 0.92

13 20 0.00028 0.48 12.3 2.5 18 39 345 363 338 373 0.85

14 20 0.012 20 7.1 0.4 18 40 373 397 369 401 0.82

15 20 0.035 60 5.6 0.2 18 39 401 419 395 429 0.80

16 20 0.0016 2.8 9.8 0.2 18 43 429 456 421 457 0.86

17 20 1.2 2e+03 0.7 1.2 18 39 457 475 454 482 0.84

18 20 0.071 1.2e+02 4.6 1.6 8 39 476 503 469 513 0.78

19 20 0.0063 11 8.0 0.4 18 39 513 531 507 541 0.85

20 20 0.0077 13 7.7 0.1 18 39 541 559 532 563 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	20	0.0036	6.2	8.7	0.6	18	39	9	27	5	37	0.83
2	20	0.69	1.2e+03	1.4	1.8	18	28	37	47	29	59	0.82
3	20	0.46	7.9e+02	2.0	1.4	18	39	65	83	54	93	0.82
4	20	4.7	8.1e+03	-1.3	3.5	17	39	92	111	84	117	0.75
5	20	0.014	24	6.8	2.2	14	39	117	139	105	146	0.83
6	20	0.0021	3.7	9.4	0.7	17	39	148	167	141	174	0.88
7	20	0.0016	2.8	9.8	0.6	17	39	176	195	169	205	0.83
8	20	0.0012	2	10.3	0.9	18	39	205	223	197	233	0.83
9	20	0.62	1.1e+03	1.6	2.2	18	39	233	251	224	263	0.79
10	20	3.7	6.3e+03	-0.9	1.5	18	39	261	279	253	289	0.75
11	20	0.034	57	5.6	1.4	9	39	281	307	273	311	0.77
12	20	0.0008	1.4	10.8	0.3	18	40	317	336	314	339	0.92
13	20	0.00028	0.48	12.3	2.5	18	39	345	363	338	373	0.85
14	20	0.012	20	7.1	0.4	18	40	373	397	369	401	0.82
15	20	0.035	60	5.6	0.2	18	39	401	419	395	429	0.80
16	20	0.0016	2.8	9.8	0.2	18	43	429	456	421	457	0.86
17	20	1.2	2e+03	0.7	1.2	18	39	457	475	454	482	0.84
18	20	0.071	1.2e+02	4.6	1.6	8	39	476	503	469	513	0.78
19	20	0.0063	11	8.0	0.4	18	39	513	531	507	541	0.85
20	20	0.0077	13	7.7	0.1	18	39	541	559	532	563	0.90

Sequence Information

Coding Sequence: ATGCATgggggcaagaagccacataaatgtgaagtttgtgggaagagttttacttGGACATCTAATATAAAGAGACATCTcttgatacatgagggtaagaagccacataaatgtgaaatttgtggtaagagctttacccaggcatgtcatttaaggggacatcttttgacgcatgagggtaagaaaccacatgaATGTGAAGTTTGTAGTAAGAGCTTTACACAGACATCTGATTTAAGGAtgcatcttttgatacatgagggtaaaaaattacataaatgtgaaatttgtagaAAAAGCTTTATCACACCATCTCATTTAAGTAGACATCTTTTGTTGCATGAgagtaagaaaccatataaatgtgaagtttgtggaaagagctttaccaaGACATCTACTTTAAAGGGACATCTTTCggtgcatgagggtaagaaaccatataaatgtgaaatttgtgggaagagctttaccaagACATCTACTTTAAAGGGACATCTTTCcgtgcatgagggtaagaaaccatataaatgtgaaatttgtggaaagagctttaacCAAACATCTACTTTAAAGGGACATCTTTTGGTgcacgagggtaagaaaccacataaatgtgaagtttgtgggaagagctttaccacAACATCTggtttaaggaaacatcttttgatacatgagggtaagaaaccacataaatgtgaagtttgtgggaagcgCTTTACTGTGACATATGGTTTAAGGATACATCTGTTGATacacgagggtaagaaaccacataaatgtgaaatgtgtaGAAAGAGCTTTATCACGCCATCTGATTTAAAGAGACACCTTTtgctgcatgagggtaagaaaccacataaatgtgaagtttgtgaaaagagTTTTGCCACGACATCTACTTTAAAGGGACATCTTATGGTGCACTGGGGTattaaaccatataaatgtgaaatttgtgggaagagctttaaccAGACATCTAGTTTAAGGAGTCATCTTGTggtgcatgagggtaagaaaccatataaatgtgaaatttgtgggaagagctttaaaCGAACATCTCATTTAAAGAGGCATCTTATGTTGCATGAGGGTgtgaaaccacataaatgtgaagtttgtgggaagagctttgccACGACATCTACATTAAAGGGACATCTTTTGGTGCACGAGGTtaggaaaccacataaatgtgaaatttgtgggaagagctttgccCAGGCATCTACTCTAAAGGGACATCTTTTGGGccacgagggtaagaaaccacataaatgtggaGTTTGTGGGAAGGGCTTTACCTGGACATCTggtttaaggaaacatcttttgatacatgagggtaagagaccacataaatgtgaaatttgtagaAAGAGCTTTATCATACCATCtgatttaaggagacatcttttgctGCATGAGGATAAGAAGCCATacaaatgtaaagtttgtgggatGCTCTTTACGGAGACTTCTACTTTAAAGGGACATCTTTTggtgcatgagggtaagaaaccacataaatgtgaaatttgtgggaagagctttacccagacatctTCTTTAAAGGGACATCTTTTggtgcatgagggtaagaaacctcATGAATGTGaggtttgtgggaagagcttttcCTGGCCATctaatttaaggagacatcttttgatgcatgagggtaagaatccatattaa
Protein Sequence: MHGGKKPHKCEVCGKSFTWTSNIKRHLLIHEGKKPHKCEICGKSFTQACHLRGHLLTHEGKKPHECEVCSKSFTQTSDLRMHLLIHEGKKLHKCEICRKSFITPSHLSRHLLLHESKKPYKCEVCGKSFTKTSTLKGHLSVHEGKKPYKCEICGKSFTKTSTLKGHLSVHEGKKPYKCEICGKSFNQTSTLKGHLLVHEGKKPHKCEVCGKSFTTTSGLRKHLLIHEGKKPHKCEVCGKRFTVTYGLRIHLLIHEGKKPHKCEMCRKSFITPSDLKRHLLLHEGKKPHKCEVCEKSFATTSTLKGHLMVHWGIKPYKCEICGKSFNQTSSLRSHLVVHEGKKPYKCEICGKSFKRTSHLKRHLMLHEGVKPHKCEVCGKSFATTSTLKGHLLVHEVRKPHKCEICGKSFAQASTLKGHLLGHEGKKPHKCGVCGKGFTWTSGLRKHLLIHEGKRPHKCEICRKSFIIPSDLRRHLLLHEDKKPYKCKVCGMLFTETSTLKGHLLVHEGKKPHKCEICGKSFTQTSSLKGHLLVHEGKKPHECEVCGKSFSWPSNLRRHLLMHEGKNPY

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00995406; iTF_00995934;
90% Identity: iTF_00995406; iTF_00995934;
80% Identity: iTF_00995406; iTF_00995934;