Mvil014921.1
Basic Information
- Insect
- Melanotus villosus
- Gene Symbol
- -
- Assembly
- GCA_963082815.1
- Location
- OY720418.1:126550114-126551467[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.019 9.9e+02 2.4 0.1 26 43 124 142 116 147 0.73 2 5 0.0014 75 6.0 0.0 22 45 150 173 139 180 0.84 3 5 0.00026 13 8.4 0.1 22 46 178 202 174 204 0.90 4 5 3e-05 1.5 11.4 0.1 21 51 205 235 203 236 0.88 5 5 0.0006 31 7.2 0.0 21 48 233 260 229 262 0.89
Sequence Information
- Coding Sequence
- ATGGAGAGTGAGGACCGAGAAGTCGAATTTCAGTCATCATTAGAACCTGATGTTATTATTGATGATGATTCGGATCGAGATGACCACTTCTACGAAAGTGAGGAAAATGGCGCACAGCATGAAATCACAAATAACTTACAGAAACGTATTGGTCCAGAAGTTTCACTTATACCAGTTAAGAAAGTCCCAATTAAagtcaaaatgtttaaaaatttacctcgCAAAGAGTTCCCGGAAACAGATGAACATAAAGTACAAAGATTTATACAGAGATCTCCAAGGCAAACCGTAAGACTGATAACAAAACAAGAACTGGTAGAAGCAGAAAATGGTAACGTTAATACGAAACGAAAATCGCTTCCTTTAGAAAAATGTCCTAtatgtaaaaaattttttcgtCGCATGAAAACGCATTTACAAAAACACGAAAGTGTAAAGAGAGATCCTAACGATCCATTAACTTGTAAATTTTGCATGAAAGTGTTCAATACTGGTAGTAACTTAAGTATACATATGCGCACACATACGGGAGATAAACCTTACATCTGTGAAATATGTACAAAAGGCTTTGCTCAGTCGTGCAATTTAGTAAATCATTTGCGCATACACACAGGTGAAAGGCCCTTTAAATGTCCACATTGTGATCGTGCTTTTACACAGTCTGGTAATCTTAGTAATCACGTGCGATTACATACCGatgaaaaaccttttaaatgtcatttttgTGACAAAGCCTTTACACAGTCTGGCAATCTAAATTCGCATATTAGAAACAATCATAAATTTTTAGGTAATATCGAAAGCGAACTGAACGACGATGTTCAGTAG
- Protein Sequence
- MESEDREVEFQSSLEPDVIIDDDSDRDDHFYESEENGAQHEITNNLQKRIGPEVSLIPVKKVPIKVKMFKNLPRKEFPETDEHKVQRFIQRSPRQTVRLITKQELVEAENGNVNTKRKSLPLEKCPICKKFFRRMKTHLQKHESVKRDPNDPLTCKFCMKVFNTGSNLSIHMRTHTGDKPYICEICTKGFAQSCNLVNHLRIHTGERPFKCPHCDRAFTQSGNLSNHVRLHTDEKPFKCHFCDKAFTQSGNLNSHIRNNHKFLGNIESELNDDVQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00789909;
- 90% Identity
- iTF_00978812;
- 80% Identity
- iTF_00978812;