Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.27 3.9e+03 -1.7 0.8 11 16 13 18 11 19 0.71

2 4 0.33 4.7e+03 -2.0 4.0 12 15 33 36 32 49 0.61

3 4 1.2e-10 1.8e-06 28.1 1.5 3 21 52 70 51 71 0.93

4 4 0.27 3.8e+03 -1.7 5.0 10 15 84 89 83 92 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.27	3.9e+03	-1.7	0.8	11	16	13	18	11	19	0.71
2	4	0.33	4.7e+03	-2.0	4.0	12	15	33	36	32	49	0.61
3	4	1.2e-10	1.8e-06	28.1	1.5	3	21	52	70	51	71	0.93
4	4	0.27	3.8e+03	-1.7	5.0	10	15	84	89	83	92	0.84

Coding Sequence: ATGTCTGACGATGGTTCAACGGCGTTTGAGAAGAAAGGACGAGGTAGATCTAAAACTAACGGAACACAAtcggaagCCAAAGGGGATGGCAAAAAGAGAGGCAGACCTGTAACACCAGCTAAGTCAAAAGAATCCAAAAATTCATCTGATGATGAACAAGTGCCAATTGCAAAAAGAGGAAGAGGTAGACCTAAAGGTTCAAAGAAAAAAGCAGCTACCTCTAAaggaaaaAGTGGATCTTGTGAGGGCCGAGGTCGTGGCAGGCCACGCAAAAATGCACCACCATCCAAAAAGGATGCAGCCTCAACTGAAGAAGAACAAGAAGATGAAGAAGAAGAGGCTTTGGATCCCTAA
Protein Sequence: MSDDGSTAFEKKGRGRSKTNGTQSEAKGDGKKRGRPVTPAKSKESKNSSDDEQVPIAKRGRGRPKGSKKKAATSKGKSGSCEGRGRGRPRKNAPPSKKDAASTEEEQEDEEEEALDP

Sequence clustering based on sequence similarity using MMseqs2