Mmaz023518.1
Basic Information
- Insect
- Mechanitis mazaeus
- Gene Symbol
- -
- Assembly
- GCA_959347395.1
- Location
- OY365757.1:6908961-6909469[+]
Transcription Factor Domain
- TF Family
- HMGA
- Domain
- HMGA domain
- PFAM
- AnimalTFDB
- TF Group
- Unclassified Structure
- Description
- This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.27 3.7e+03 -1.7 0.8 11 16 13 18 11 19 0.71 2 4 0.33 4.5e+03 -2.0 4.0 12 15 33 36 32 49 0.61 3 4 1.2e-10 1.7e-06 28.1 1.5 3 21 52 70 51 71 0.93 4 4 0.27 3.6e+03 -1.7 5.0 10 15 84 89 83 92 0.84
Sequence Information
- Coding Sequence
- ATGTCTGACGATGGTTCAACGGCGTTTGAGAAGAAAGGACGAGGTAGATCTAAAACTAACGGAACACAAtcggaagCCAAAGGGGATGGCAAAAAGAGAGGCAGACCTGTAACACCAGCTAAGTCAAAAGAATCCAAAAATTCATCTGATGATGAACAAGTGCCAATTGCAAAAAGAGGAAGAGGTAGACCTAAAGGTTCAAAGAAAAAAGCAGCTACCTCTAAaggaaaaAGTGGATCTTGTGAGGGCCGAGGTCGTGGCAGGCCACGCAAAAATGCACCACCATCCCAAAAGGATGCAGCCTCAACTGAAGAAGAACAAGAAGATGAAGAAGAAGAGGCTTTGGATCCCTAA
- Protein Sequence
- MSDDGSTAFEKKGRGRSKTNGTQSEAKGDGKKRGRPVTPAKSKESKNSSDDEQVPIAKRGRGRPKGSKKKAATSKGKSGSCEGRGRGRPRKNAPPSQKDAASTEEEQEDEEEEALDP
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01115716;
- 90% Identity
- iTF_00960182; iTF_00958680;
- 80% Identity
- iTF_00958680;