Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0023 72 4.0 1.8 11 16 13 18 11 20 0.83

2 4 1 3.2e+04 -5.1 1.4 12 14 33 35 33 35 0.91

3 4 2.6e-10 8.2e-06 26.1 1.7 4 21 53 70 50 71 0.87

4 4 0.62 2e+04 -3.8 6.9 10 15 82 87 81 88 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0023	72	4.0	1.8	11	16	13	18	11	20	0.83
2	4	1	3.2e+04	-5.1	1.4	12	14	33	35	33	35	0.91
3	4	2.6e-10	8.2e-06	26.1	1.7	4	21	53	70	50	71	0.87
4	4	0.62	2e+04	-3.8	6.9	10	15	82	87	81	88	0.83

Coding Sequence: ATGTCTGATGACGGTTCTACTGCTGTTGAGAAGAAAGGGCGCGGTAGACCAAAAGCAAATGGAACCCAATCGgaAGCAAAAGGAGATACCAAGAAAAGGGGTCGGCAACCTGTACCAGCGAAAGCAAAAGAATCTGCTAAGTCTTCTGATGAAGAACAAGCACCGGTAGCGAAAAGAGGGAGAGGTAGACCTAAAGGCTCAAAGAAAAAGGCAGCAGCAAAAAAGAGTGCACCAGTTGAAGGCAGAGGGCGTGGCAGGCCACGGAAGGATGCTCCACCCAAAAAGGATGCTGCTACGTCTGAGGAAGACcaggatgaagaagatgaagagGAAGGCTCTGACCAGTAA
Protein Sequence: MSDDGSTAVEKKGRGRPKANGTQSEAKGDTKKRGRQPVPAKAKESAKSSDEEQAPVAKRGRGRPKGSKKKAAAKKSAPVEGRGRGRPRKDAPPKKDAATSEEDQDEEDEEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2