Mlit023383.1
Basic Information
- Insect
- Macaria liturata
- Gene Symbol
- Litaf_1
- Assembly
- GCA_964023185.1
- Location
- OZ026829.1:9747801-9749221[+]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5.8e-25 1.3e-21 77.1 16.5 2 69 58 126 57 127 0.94
Sequence Information
- Coding Sequence
- ATGGGTCTACCTCCCCCGTACGAGCAGTCGCAGCCCAACCCAGCACCACCTCCGTCCTACTTCGGAGACAACCCTCCACAACCAGCTGGCTTCGTGGTCCCTGCAGCTGCTCCGCGCACCACCGTCATTACTTCTGGGCCTGGCAACCCTCCGCCTGTAAAACTAGGCCCGGGACCAACTGGCACCACCTGTGCCTCGTGTCACAAGAGTATCGTCACACGAGTGGACTATGTGCCTAATAATAGGACGCACATCGTGTCGGCTGCTCTCTGTGTCCTAGCTGGATGCTGCTGCGGCTGCTTCGTGCCGTACTGCATGCGTTCGTGCAAGACTGCCAACCACTACTGCCCGCAGTGCCGCGCCTTCGTCGGCTCCTACACGCCCTCCTGA
- Protein Sequence
- MGLPPPYEQSQPNPAPPPSYFGDNPPQPAGFVVPAAAPRTTVITSGPGNPPPVKLGPGPTGTTCASCHKSIVTRVDYVPNNRTHIVSAALCVLAGCCCGCFVPYCMRSCKTANHYCPQCRAFVGSYTPS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00828449; iTF_00078053; iTF_00151208; iTF_00027435; iTF_00178841; iTF_00028378; iTF_00275937; iTF_00463046; iTF_01246506; iTF_01337450; iTF_01404013; iTF_00009680; iTF_01501758; iTF_00844988; iTF_00409951; iTF_00411067; iTF_01565280; iTF_01437634; iTF_01083910; iTF_01417387; iTF_00007670; iTF_00762234; iTF_01416446; iTF_00682054; iTF_00683852; iTF_00448690; iTF_00682997; iTF_01335606; iTF_00319390; iTF_01282981; iTF_01281895; iTF_00077162; iTF_01279853; iTF_01280974; iTF_00076125; iTF_00206665; iTF_00432809; iTF_01503505; iTF_01504396; iTF_00034386; iTF_01172936; iTF_00927178; iTF_01208879; iTF_00914161; iTF_00910197; iTF_01072118; iTF_01125113; iTF_01126028; iTF_00674824; iTF_00994891; iTF_01492559; iTF_00383282; iTF_00285077; iTF_00036297; iTF_00237146; iTF_00390972; iTF_00251022; iTF_00125587; iTF_00408958; iTF_00650560; iTF_00791754; iTF_00790868; iTF_00649686;
- 90% Identity
- iTF_00143564;
- 80% Identity
- -