Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.00014 0.12 12.0 0.1 13 47 12 46 9 51 0.86

2 7 0.0028 2.4 7.9 0.1 21 48 48 75 45 81 0.85

3 7 1.2 1.1e+03 -0.6 0.0 37 45 108 116 95 124 0.75

4 7 0.00027 0.23 11.2 0.1 26 47 153 174 145 181 0.79

5 7 0.1 90 2.9 0.0 23 46 178 201 174 208 0.84

6 7 0.64 5.5e+02 0.3 0.1 21 32 204 215 201 230 0.77

7 7 0.0021 1.8 8.3 0.3 21 45 232 256 222 264 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.00014	0.12	12.0	0.1	13	47	12	46	9	51	0.86
2	7	0.0028	2.4	7.9	0.1	21	48	48	75	45	81	0.85
3	7	1.2	1.1e+03	-0.6	0.0	37	45	108	116	95	124	0.75
4	7	0.00027	0.23	11.2	0.1	26	47	153	174	145	181	0.79
5	7	0.1	90	2.9	0.0	23	46	178	201	174	208	0.84
6	7	0.64	5.5e+02	0.3	0.1	21	32	204	215	201	230	0.77
7	7	0.0021	1.8	8.3	0.3	21	45	232	256	222	264	0.84

Coding Sequence: tgCAGAAAGTCGtttattcaaaaagttcatcTGGAAAAACATTGGCGAAGACATACTAAAGAGAAACCTTTCCAATGTctaatttgtaaatctttatttactgGAAGCAGTTCTCTTAAAAGGCACATTCTAATACATACCGGGGAGAAACCttttcagtgtgaaatttgtaatTCCACATTTAGCCAAAAATGTAATCTCTTGAGTCACATGCGAACACATACTGGtgtgaaaccatttcagtgtgaattgtgtgaaaaatcatttacaacatcATCCATTCTCAAGACGCACAGGCTAACACACACTGGGgtgaaaccatttcaaaatctTAAGAGGCACATGCTAACGCACTCTGAAGTAAAACCATTTAAGtgtgaaaaatgtgaaaagtCATTTAGTTTAAAAAGTATTCTACAAAATCACGCCCACACACATACTCGGGATAAatcttttcaatgtgaaatttgtcaaTCCTTATTTAGCCAAAGCCGTTATCTCAAGAAGCACATGCTTACGCATACAGGGGTGAAACCATTTGTCTgcgaaatatgtcaaaaatcatttaaaacatcaTCCATTCTAAAGACGCACATGCTAGTACACTCTGGGGAGAAACCATTTAAGTGTGacatatgtcaaaaatattttagtctaaAATGTATTCTCAAAAATCACATCCGTACACATACTCGGGAGAagccttttcaatgtgaaatttgtcaaTCCTCATTTAGCCAAAGCAGTCATCTTAACAAGCACAAACGAACACATTCTGGGGAGAAACCATCTAAGcgtaaa
Protein Sequence: CRKSFIQKVHLEKHWRRHTKEKPFQCLICKSLFTGSSSLKRHILIHTGEKPFQCEICNSTFSQKCNLLSHMRTHTGVKPFQCELCEKSFTTSSILKTHRLTHTGVKPFQNLKRHMLTHSEVKPFKCEKCEKSFSLKSILQNHAHTHTRDKSFQCEICQSLFSQSRYLKKHMLTHTGVKPFVCEICQKSFKTSSILKTHMLVHSGEKPFKCDICQKYFSLKCILKNHIRTHTREKPFQCEICQSSFSQSSHLNKHKRTHSGEKPSKRK

Sequence clustering based on sequence similarity using MMseqs2