Ilum015125.1
Basic Information
- Insect
- Ignelater luminosus
- Gene Symbol
- -
- Assembly
- GCA_011009095.1
- Location
- Ilumi1.2:1860-3117[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.016 1.5e+02 3.2 0.1 25 43 125 144 113 150 0.70 2 5 0.0025 23 5.8 0.0 22 47 152 177 147 184 0.83 3 5 0.0028 25 5.7 0.1 22 46 180 204 175 206 0.88 4 5 4.2e-05 0.39 11.5 0.1 21 51 207 237 203 238 0.88 5 5 0.00097 8.9 7.1 0.0 21 48 235 262 233 265 0.90
Sequence Information
- Coding Sequence
- ATGATGGAGAATGAGGAACAAGAAGTCGATTTTCATTCAACATTGGAACCTGATGTTATCATTGATGATAATTCGAGTAATGGGCAGTTCTATGGAAATACAGAAGGAAATGGGCATGAAGATATTTCAGATAATAATTCTCAAGACGAAATTGGTCCCGAAGTGTCACTCATACCAGTTTCAAGAAGTTCGATTAAAGTTAAGATATTTGACAGCATGCCACATAAAGACACATCATCTGATTCAGAAGAACGTAAAGTACAAAGAATTCTACAGAGATCTCCTCGAACAACTGTAAGACTGATATCTAAAGAAGAAATGATACAAGCAGAAAATGGTAACACTAACTCTAAAAGAAAGTCACTTCCCTTAGAAAAATGTCCTATATGTAAAAAGTTCTTCCGGCGTATGAAAACTCATTTACAGAAACATGAAAATGTAAAACGAGATCCTAACGATCCTTTAACGTGTCGATTTTGTATGAAAGTTTTTAACACAGGTAGTAATCTAAGTATACATATGAGGACACATACAGGAGACAAACCTTACATATGTGAGGTATGTACCAAAGGATTTGCTCAATCCTGTAATCTAGTAAATCACATGCGTATTCATACTGGTGAAAGACCATTTAAATGTCCACATTGTGATCGTGCATTTACACAATCTGGTAATCTCAGTAATCATGTAAGGTTACATACTGATGAAAAACCATTCAAATGCCATTTTTGCGATAAAGCTTTTACTCAGTCAGGCAATCTCAATTCTCACATACGAAACAATCATAAATTTATAGATAATATTCCAAATAACATTGAAAGTGAATTGAATAATCTCATTCAGTAA
- Protein Sequence
- MMENEEQEVDFHSTLEPDVIIDDNSSNGQFYGNTEGNGHEDISDNNSQDEIGPEVSLIPVSRSSIKVKIFDSMPHKDTSSDSEERKVQRILQRSPRTTVRLISKEEMIQAENGNTNSKRKSLPLEKCPICKKFFRRMKTHLQKHENVKRDPNDPLTCRFCMKVFNTGSNLSIHMRTHTGDKPYICEVCTKGFAQSCNLVNHMRIHTGERPFKCPHCDRAFTQSGNLSNHVRLHTDEKPFKCHFCDKAFTQSGNLNSHIRNNHKFIDNIPNNIESELNNLIQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00789909;
- 90% Identity
- iTF_00838930;
- 80% Identity
- iTF_00838930;