Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0067 2.6e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 4 0.036 1.3e+03 0.1 0.9 12 15 33 36 30 37 0.91

3 4 3.4e-10 1.3e-05 25.8 3.3 6 22 55 71 51 71 0.87

4 4 0.64 2.4e+04 -3.9 6.9 10 15 83 88 82 89 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0067	2.6e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	4	0.036	1.3e+03	0.1	0.9	12	15	33	36	30	37	0.91
3	4	3.4e-10	1.3e-05	25.8	3.3	6	22	55	71	51	71	0.87
4	4	0.64	2.4e+04	-3.9	6.9	10	15	83	88	82	89	0.83

Coding Sequence: ATGTCTGATGATGGTTCAACCGTTGTAGAGAAGAAAGGACGCGGCAGACCTAAATCCAATGGAACACAAGCAGAGGCCAAAGGTGATAGCAAGAAAAGAGGCAGACCACCAGCACCAGCCAGGACTAAAGAATCAGCAAAATCATCTGACGATGAGCAAGCACCTATAGCAAAAAGAGGAAGAGGACGGCCTAAGGGTTCCAAGAAAAAATCATCCGCAAGAGGAAAGAGTGCACCGGTTGAAGGACGGGGACGTGGACGACCACGTAAGGACCCAGCACCACCTAAAAAAGATGCTGCCTCAACTGAAGAGGAACAGGATGAAGATGATGAAGATGAGGGTTCTGAAGAACAGTAA
Protein Sequence: MSDDGSTVVEKKGRGRPKSNGTQAEAKGDSKKRGRPPAPARTKESAKSSDDEQAPIAKRGRGRPKGSKKKSSARGKSAPVEGRGRGRPRKDPAPPKKDAASTEEEQDEDDEDEGSEEQ

Sequence clustering based on sequence similarity using MMseqs2