Hdun013674.1
Basic Information
- Insect
- Hirtodrosophila duncani
- Gene Symbol
- -
- Assembly
- GCA_037043425.1
- Location
- JBAMBM010000806.1:773599-774063[+]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 3.5e-12 4.6e-09 36.4 16.0 2 68 49 118 48 120 0.79
Sequence Information
- Coding Sequence
- ATGACCACAACACTCAgcgaggaggagcagcagcagcgcgcaatggccgctgcagctgccaaAGATCTGGAGGCCCAGAAGGAGCGTGAGATATATGAGAACTTTGCCACACCCTTGGTTGGTACATTTCTCAATTTGCCACACGAATCTGTGCTGATTAAGTGTCCTGCCTGCGGCGTTAAGGATCAGAGTGTGGTCGAAAATGATCTCAAGTGGTGGGCCAGCGAGATAAATCGCATTGTTGGCTGTCTCTTTGTGaccttttgttgctgttgttgcttcaaCTATATAATACCCTGCAAGCAAACCGATCGTAGCCATTATTGCGCCAACTGTGGCTGCTACTTTGGACGCGCCATGAAGCGACGAGCCCCACTGAAACTGAAGGGGAAATAA
- Protein Sequence
- MTTTLSEEEQQQRAMAAAAAKDLEAQKEREIYENFATPLVGTFLNLPHESVLIKCPACGVKDQSVVENDLKWWASEINRIVGCLFVTFCCCCCFNYIIPCKQTDRSHYCANCGCYFGRAMKRRAPLKLKGK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00531364; iTF_00572993; iTF_00510946; iTF_00547042; iTF_01320866; iTF_00510212; iTF_00506534; iTF_00508775; iTF_00496264; iTF_00568648; iTF_00587080; iTF_00475626; iTF_00502923; iTF_00526987; iTF_01322316; iTF_01323788; iTF_00534990; iTF_00561422; iTF_00805646; iTF_00520304; iTF_00538640; iTF_00803280; iTF_00532786; iTF_00545651; iTF_01323059; iTF_00537908; iTF_00559893; iTF_00563574; iTF_00491192; iTF_00573721; iTF_00617306; iTF_00804058; iTF_00551260; iTF_00567933; iTF_01324573; iTF_00544895; iTF_00589928; iTF_00585642; iTF_00608862; iTF_00558335; iTF_00493321; iTF_00587818; iTF_00589228; iTF_00598558; iTF_00595631; iTF_00513136; iTF_00579665; iTF_01326070; iTF_01326837; iTF_00614584; iTF_00521025; iTF_00556898; iTF_00562858; iTF_00509495; iTF_00472731; iTF_00472732; iTF_00554077; iTF_00516670; iTF_00540769; iTF_00551981; iTF_00479854; iTF_00599983; iTF_00494065; iTF_00473460; iTF_00554749; iTF_00919560; iTF_00918722; iTF_00914994; iTF_00915896; iTF_00917723; iTF_00916861; iTF_00590630; iTF_00485537; iTF_00489057; iTF_00613186; iTF_00533476; iTF_00532039; iTF_00527720; iTF_00565769; iTF_00480554; iTF_00613866; iTF_00594925; iTF_00526255; iTF_00594223; iTF_00541459; iTF_00572276; iTF_00491895; iTF_00606743; iTF_00570072; iTF_00478393; iTF_00490458; iTF_00489758; iTF_00524798; iTF_00492639; iTF_00618016;
- 90% Identity
- iTF_00359896;
- 80% Identity
- -