Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.91 8.7e+02 -0.3 0.0 25 48 93 116 85 118 0.81

2 9 0.00013 0.12 12.0 0.2 18 48 115 145 105 148 0.92

3 9 0.00065 0.62 9.7 0.3 19 48 145 174 144 177 0.86

4 9 0.036 34 4.1 0.5 21 48 176 203 173 208 0.81

5 9 0.028 26 4.5 1.4 21 50 205 234 201 236 0.87

6 9 0.0061 5.8 6.6 1.4 21 49 234 262 232 267 0.84

7 9 0.021 20 4.9 0.7 18 44 260 286 259 291 0.83

8 9 0.012 11 5.7 0.4 20 48 291 319 287 321 0.85

9 9 6.6e-05 0.063 12.9 2.3 17 49 317 349 315 353 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.91	8.7e+02	-0.3	0.0	25	48	93	116	85	118	0.81
2	9	0.00013	0.12	12.0	0.2	18	48	115	145	105	148	0.92
3	9	0.00065	0.62	9.7	0.3	19	48	145	174	144	177	0.86
4	9	0.036	34	4.1	0.5	21	48	176	203	173	208	0.81
5	9	0.028	26	4.5	1.4	21	50	205	234	201	236	0.87
6	9	0.0061	5.8	6.6	1.4	21	49	234	262	232	267	0.84
7	9	0.021	20	4.9	0.7	18	44	260	286	259	291	0.83
8	9	0.012	11	5.7	0.4	20	48	291	319	287	321	0.85
9	9	6.6e-05	0.063	12.9	2.3	17	49	317	349	315	353	0.87

Coding Sequence: atggcTGACGAAACTGGATCTGctttCCCTTCAATTGATATCAAAGAAGAGGAAACAATGCATATTTATTATGgtGGTCTTACTCATGTGAAACAAGAAGAAGAAAGGCTTCTCTCAGATGATGGTCCAACTATGAAAGAAGAGGAAGAAACTCAGATGTATTCCGGTGGCAAGATTGCTCTTGATAAGAATGTGATAAGTGAGGATCCTTCAGAAGCTAAGATcaacatagatttaaaaaaaaatgcaaccaCTCACCAAACAGTTGAGAAGTTCTTTCAATGTCcccattgtgattataaatcactATATTctggaaatatgaaaatacatattatggGACGTCATACAGATGAGAAACCTTATCTCTGCCCTTATTGTGATTATAGGACAGCTAAGTCAGAACATATGAAACGGCATTTAATGGCCCGTCACACTGGAGAGAAACCACATAAATGTCCATATTGCGATTATAAAGCAGTACAAATTGGCAATCTGCAAAGACATGTGATGTATAGTCATACAGGTGAAAAGCCCCATCAGTGTCCTCATTGCGATTATAAATCAGTCAATTCGGCCCATATAAAAAGACATATAATGACCCTCCATACTGAGGAGAAGCCCCatcagtgtcctcattgtgattttAGATCTATAACACTTCGTAAATTAAGAGCACACATTAATGCCGAGCATAGAGCTGACCATCCATTTTgttgtcctcattgtgattataaaacgGTTAATACTGATCATTTGAAAAGACATTTGATGGCCcgtcatacaggtgagaagcctcatcaatgtcctcactgtgagTATAAAGCTGTTGAAACCCgtagtttaaaaaatcatataatgtcCATTCATACaagtgagaagcctcatcaatgtcctgaTTGTGAATACAAAAcggtaacaatttataatttaaaactacatGTAATGGCCCGGCATAAACGTGAGAATCCTCATCattgtcctcattgtgattataaaactGTACAGCATAGCAAtttaaaaagacatataatgTCCCGTCATAAAAGTGTTAAGCCTcattaa
Protein Sequence: MADETGSAFPSIDIKEEETMHIYYGGLTHVKQEEERLLSDDGPTMKEEEETQMYSGGKIALDKNVISEDPSEAKINIDLKKNATTHQTVEKFFQCPHCDYKSLYSGNMKIHIMGRHTDEKPYLCPYCDYRTAKSEHMKRHLMARHTGEKPHKCPYCDYKAVQIGNLQRHVMYSHTGEKPHQCPHCDYKSVNSAHIKRHIMTLHTEEKPHQCPHCDFRSITLRKLRAHINAEHRADHPFCCPHCDYKTVNTDHLKRHLMARHTGEKPHQCPHCEYKAVETRSLKNHIMSIHTSEKPHQCPDCEYKTVTIYNLKLHVMARHKRENPHHCPHCDYKTVQHSNLKRHIMSRHKSVKPH

Sequence clustering based on sequence similarity using MMseqs2