Basic Information

Insect: Halyomorpha halys
Gene Symbol: -
Assembly: GCA_000696795.2
Location: NW:9466-21213[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.011 0.46 10.6 1.1 1 23 93 116 93 116 0.93

2 9 0.00045 0.018 15.0 1.6 1 23 122 145 122 145 0.93

3 9 0.00021 0.0082 16.0 0.7 1 23 151 174 151 174 0.95

4 9 0.00016 0.0065 16.4 4.3 1 23 180 203 180 203 0.98

5 9 0.00076 0.03 14.3 1.8 1 23 209 232 209 232 0.95

6 9 0.00073 0.029 14.3 6.1 1 23 238 261 238 261 0.94

7 9 0.0065 0.26 11.3 1.8 1 23 267 290 267 290 0.97

8 9 0.0007 0.028 14.4 0.7 1 23 296 319 296 319 0.94

9 9 0.00032 0.013 15.5 8.5 1 23 325 348 325 348 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.011	0.46	10.6	1.1	1	23	93	116	93	116	0.93
2	9	0.00045	0.018	15.0	1.6	1	23	122	145	122	145	0.93
3	9	0.00021	0.0082	16.0	0.7	1	23	151	174	151	174	0.95
4	9	0.00016	0.0065	16.4	4.3	1	23	180	203	180	203	0.98
5	9	0.00076	0.03	14.3	1.8	1	23	209	232	209	232	0.95
6	9	0.00073	0.029	14.3	6.1	1	23	238	261	238	261	0.94
7	9	0.0065	0.26	11.3	1.8	1	23	267	290	267	290	0.97
8	9	0.0007	0.028	14.4	0.7	1	23	296	319	296	319	0.94
9	9	0.00032	0.013	15.5	8.5	1	23	325	348	325	348	0.96

Sequence Information

Coding Sequence: atggcTGACGAAACTGGATCTGctttCCCTTCAATTGATATCAAAGAAGAGGAAACAATGCATATTTATTATGgtGGTCTTACTCATGTGAAACAAGAAGAAGAAAGGCTTCTCTCAGATGATGGTCCAACTATGAAAGAAGAGGAAGAAACTCAGATGTATTCCGGTGGCAAGATTGCTCTTGATAAGAATGTGATAAGTGAGGATCCTTCAGAAGCTAAGATcaacatagatttaaaaaaaaatgcaaccaCTCACCAAACAGTTGAGAAGTTCTTTCAATGTCcccattgtgattataaatcactATATTctggaaatatgaaaatacatattatggGACGTCATACAGATGAGAAACCTTATCTCTGCCCTTATTGTGATTATAGGACAGCTAAGTCAGAACATATGAAACGGCATTTAATGGCCCGTCACACTGGAGAGAAACCACATAAATGTCCATATTGCGATTATAAAGCAGTACAAATTGGCAATCTGCAAAGACATGTGATGTATAGTCATACAGGTGAAAAGCCCCATCAGTGTCCTCATTGCGATTATAAATCAGTCAATTCGGCCCATATAAAAAGACATATAATGACCCTCCATACTGAGGAGAAGCCCCatcagtgtcctcattgtgattttAGATCTATAACACTTCGTAAATTAAGAGCACACATTAATGCCGAGCATAGAGCTGACCATCCATTTTgttgtcctcattgtgattataaaacgGTTAATACTGATCATTTGAAAAGACATTTGATGGCCcgtcatacaggtgagaagcctcatcaatgtcctcactgtgagTATAAAGCTGTTGAAACCCgtagtttaaaaaatcatataatgtcCATTCATACaagtgagaagcctcatcaatgtcctgaTTGTGAATACAAAAcggtaacaatttataatttaaaactacatGTAATGGCCCGGCATAAACGTGAGAATCCTCATCattgtcctcattgtgattataaaactGTACAGCATAGCAAtttaaaaagacatataatgTCCCGTCATAAAAGTGTTAAGCCTcattaa
Protein Sequence: MADETGSAFPSIDIKEEETMHIYYGGLTHVKQEEERLLSDDGPTMKEEEETQMYSGGKIALDKNVISEDPSEAKINIDLKKNATTHQTVEKFFQCPHCDYKSLYSGNMKIHIMGRHTDEKPYLCPYCDYRTAKSEHMKRHLMARHTGEKPHKCPYCDYKAVQIGNLQRHVMYSHTGEKPHQCPHCDYKSVNSAHIKRHIMTLHTEEKPHQCPHCDFRSITLRKLRAHINAEHRADHPFCCPHCDYKTVNTDHLKRHLMARHTGEKPHQCPHCEYKAVETRSLKNHIMSIHTSEKPHQCPDCEYKTVTIYNLKLHVMARHKRENPHHCPHCDYKTVQHSNLKRHIMSRHKSVKPH

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00764339;
90% Identity: iTF_00764339;
80% Identity: iTF_00764339;