Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.00041 2.8 10.0 1.0 21 48 49 76 30 77 0.85

2 7 0.00054 3.6 9.6 0.1 20 48 77 105 74 111 0.87

3 7 0.64 4.3e+03 -0.2 0.0 22 45 108 131 104 136 0.81

4 7 0.00044 2.9 9.9 0.3 21 49 136 164 127 168 0.88

5 7 0.03 2e+02 4.0 0.2 23 48 167 192 164 194 0.88

6 7 2.4e-07 0.0016 20.3 1.8 17 49 190 222 188 226 0.86

7 7 0.00052 3.5 9.7 0.3 17 48 219 250 217 252 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.00041	2.8	10.0	1.0	21	48	49	76	30	77	0.85
2	7	0.00054	3.6	9.6	0.1	20	48	77	105	74	111	0.87
3	7	0.64	4.3e+03	-0.2	0.0	22	45	108	131	104	136	0.81
4	7	0.00044	2.9	9.9	0.3	21	49	136	164	127	168	0.88
5	7	0.03	2e+02	4.0	0.2	23	48	167	192	164	194	0.88
6	7	2.4e-07	0.0016	20.3	1.8	17	49	190	222	188	226	0.86
7	7	0.00052	3.5	9.7	0.3	17	48	219	250	217	252	0.90

Coding Sequence: ATGGGAAATGGATATTTCTTTACACACCCTCAAGGACATTCATCAATGGAGGCTCCAACGAATATGGCATACCAATGCGATCAGTGTAATTACGCTACAGACAAACCAACTGCCTTAAAGAgtcatataaaaacaaaacatgccATCGAAAAATCGCTCCAATGTCCTCATTGTGAATACATTGCGTCTCAAAGCACCCACCTGAAAAGACACATCGCAGCACAGCATAGCAGTGACAAACCTAATAAATGCCCTTACTGTACTTACAGCTCCGTCCAGCCCGGTTCGTTGAGGACTCACCTCCTCACAAAGCACTCGGATCAGAAACCTTACAAGTGTACTCATTGTGAATTCACTACTTCCGAGTCGAATGAGCTCAAGGAGCACATTGCAGGAACACATGCCGACGAAAAGCCGTACAAGTGTCCTCTCTGTGAGTATTGCGCTTCCGAAACGAGCGTCCTCCGCAAACACATCACCACAAAGCACATAAAGCAGAAGCCGTACCAGTGCCCACATTGTGACTACTGTACCGCACTGTCTGGAAACCTCAAAGTCCACGTGATGTCGAAGCATACAAAAGAGAAACCCCATCAATGCCCTCATTGTAAATACGCTGCCGTCCAGTCTGCAAACCTTCGCCGGCACATTATTTCCCGACACACGAAAGATAAGCCATTCCAGTGTATATTGTGTAACTACAGCGCTTCTCAGTCTGTCGACTTGAGAAAACACATGCTGAGGAAACACAACTCGTAA
Protein Sequence: MGNGYFFTHPQGHSSMEAPTNMAYQCDQCNYATDKPTALKSHIKTKHAIEKSLQCPHCEYIASQSTHLKRHIAAQHSSDKPNKCPYCTYSSVQPGSLRTHLLTKHSDQKPYKCTHCEFTTSESNELKEHIAGTHADEKPYKCPLCEYCASETSVLRKHITTKHIKQKPYQCPHCDYCTALSGNLKVHVMSKHTKEKPHQCPHCKYAAVQSANLRRHIISRHTKDKPFQCILCNYSASQSVDLRKHMLRKHNS

Sequence clustering based on sequence similarity using MMseqs2