Gmor011286.1
Basic Information
- Insect
- Glossina morsitans
- Gene Symbol
- br_3
- Assembly
- None
- Location
- scf7180000649239:4035-5618[-]
Transcription Factor Domain
- TF Family
- BTB
- Domain
- zf-C2H2|ZBTB
- PFAM
- PF00651
- TF Group
- Zinc-Coordinating Group
- Description
- The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 4.3e-22 6.3e-20 70.9 0.1 1 84 24 104 24 111 0.90
Sequence Information
- Coding Sequence
- ATGGCTCAGAGAAGTCATCAGTATTTTAGTTTGCGCTGGAACAACTATCAAAACACCATGACTTCGGTGTTCCAGCAATTGCGTGAAGATTTATCATTTGTGGATGTAACGCTTTCCTGTGAACATGGTTCCCTGAAAGCCCACAAGGTTGTACTCTCCGCGTGCTCTTCATATTTTCAAAAATTATTGCTGGAAAATCCTTGTAAACATCCAACGATTATATTACCGGGCGATATTATATTTACAGATTTAAAAACAATTATTGATTTTGTTTATCGCGGTGAAATTGATGTCACCGAATCCGAACTACAGGTGAGTCAGCTGATGAGTTCATTATAA
- Protein Sequence
- MAQRSHQYFSLRWNNYQNTMTSVFQQLREDLSFVDVTLSCEHGSLKAHKVVLSACSSYFQKLLLENPCKHPTIILPGDIIFTDLKTIIDFVYRGEIDVTESELQVSQLMSSL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00742026;
- 90% Identity
- iTF_00746833; iTF_00972355; iTF_01486405; iTF_00591062; iTF_01051300; iTF_00259878; iTF_01201000; iTF_00331625; iTF_00747593; iTF_00899748; iTF_00900743; iTF_00435727; iTF_00817555; iTF_01470644; iTF_01115125; iTF_01114370; iTF_00366615; iTF_00679645; iTF_00992765; iTF_00797889; iTF_00604194; iTF_01261122; iTF_01133027; iTF_00480260; iTF_00533189; iTF_01364038; iTF_00624871; iTF_00891079; iTF_00531753; iTF_01174377; iTF_00593930; iTF_01165642; iTF_00350283; iTF_00612907; iTF_01398636; iTF_00555182; iTF_01175247; iTF_01313105; iTF_00919154; iTF_01505586; iTF_00617747; iTF_00892883; iTF_01074611; iTF_01399603; iTF_01189620; iTF_01224724; iTF_01374196; iTF_00491605; iTF_00524503; iTF_00571991; iTF_01315607; iTF_00258104; iTF_00485240; iTF_00967320; iTF_01196088; iTF_00490171; iTF_00590331; iTF_00199997; iTF_00489469; iTF_00655421; iTF_00565470; iTF_00979455; iTF_01427583; iTF_00259010; iTF_01109442; iTF_00555940; iTF_01314789; iTF_01177066; iTF_01201740; iTF_01194511; iTF_01259313; iTF_00371189; iTF_01235868; iTF_00384682; iTF_00742026; iTF_01553324; iTF_00483075; iTF_00588933; iTF_00537607; iTF_00553800; iTF_01554056; iTF_00494477; iTF_00606418; iTF_00890232; iTF_00556602; iTF_01322748; iTF_00603454; iTF_00901598; iTF_01376750; iTF_00716849; iTF_00495955; iTF_00508437; iTF_00614997; iTF_00997849; iTF_01045594; iTF_01162363; iTF_00653631; iTF_01397597;
- 80% Identity
- iTF_00199997;