Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.05 41 4.3 0.0 21 45 6 30 2 37 0.85

2 10 1.3 1e+03 -0.2 0.1 21 32 34 45 30 59 0.74

3 10 0.0032 2.7 8.1 0.0 21 44 60 83 54 87 0.90

4 10 0.45 3.7e+02 1.2 0.2 21 44 88 111 84 116 0.65

5 10 0.031 26 4.9 0.1 18 45 113 140 110 143 0.88

6 10 0.0035 2.9 8.0 0.0 21 46 144 169 140 175 0.90

7 10 0.13 1.1e+02 2.9 0.0 22 45 173 196 170 203 0.85

8 10 0.54 4.4e+02 1.0 0.5 21 44 200 223 196 228 0.85

9 10 0.0031 2.6 8.1 0.1 21 45 228 252 224 259 0.91

10 10 2.8 2.3e+03 -1.3 0.1 21 31 256 266 252 270 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.05	41	4.3	0.0	21	45	6	30	2	37	0.85
2	10	1.3	1e+03	-0.2	0.1	21	32	34	45	30	59	0.74
3	10	0.0032	2.7	8.1	0.0	21	44	60	83	54	87	0.90
4	10	0.45	3.7e+02	1.2	0.2	21	44	88	111	84	116	0.65
5	10	0.031	26	4.9	0.1	18	45	113	140	110	143	0.88
6	10	0.0035	2.9	8.0	0.0	21	46	144	169	140	175	0.90
7	10	0.13	1.1e+02	2.9	0.0	22	45	173	196	170	203	0.85
8	10	0.54	4.4e+02	1.0	0.5	21	44	200	223	196	228	0.85
9	10	0.0031	2.6	8.1	0.1	21	45	228	252	224	259	0.91
10	10	2.8	2.3e+03	-1.3	0.1	21	31	256	266	252	270	0.84

Coding Sequence: ATgagaacccacactggagagaaaccattcgagtgtacaatctgcaacaagaaatttgcactAAGCGCCACCTTGAGCAAACATCTCCGGACTCACACTGGAGAGAGGCCTTTTGAGTGTAAAATCTGCAAGAAGAAATTTGCAGGCTCACTGAGTCTtcacctccgaacccacacaggtgaaaagccCTTCGACTGTACAATCTGCGAGAAGAAATTTTCACAAGAGATCAACTTGCGCGTACATATCCGGAAGCATACAGGGGAGAGGCCCTACGAGTGTACTATATGCAAGAAGAAACTTGTTACAAAGGATGCCTTGACCGTACATCTCCGTAGGCACTCAGGAGAGAGGCCCTTTGATTGCTCAGTGTGTAACAAGGCATTTGCTTCTAATTCCGACTTGCGTGTTCacctgcgaacccacacaggggagaagcctTTTCAGTGTGacatctgcaacaagaaatttacaacAAGCAGCCATTTACGCGGGCACCTCCATATGCACACAGGAGAAACTCCCTTCGAGTGTGCaatctgcaacaaaaaatttgcAGAGAAACGTGGATTGAGCGGTCATCTCCGTACACACACAAGAGAGAGGCCCTACAAATGTACAGTCTGCAATAAGCAATGTTCATCAAAGAGCAATTTGGTCGTACATTTACGGACCCAtaccggagagaagccatatgagtgcacaatctgcaacaagaaatttggaCATAGCAACAGTCTGCGTCAACATCTCCGGGGCCACACAGGAGAAACCCCATATGAATGcacaatctgcaacaagaaatttaaagGAAAGCCATATAGGAGAGAAGAAATTTGA
Protein Sequence: MRTHTGEKPFECTICNKKFALSATLSKHLRTHTGERPFECKICKKKFAGSLSLHLRTHTGEKPFDCTICEKKFSQEINLRVHIRKHTGERPYECTICKKKLVTKDALTVHLRRHSGERPFDCSVCNKAFASNSDLRVHLRTHTGEKPFQCDICNKKFTTSSHLRGHLHMHTGETPFECAICNKKFAEKRGLSGHLRTHTRERPYKCTVCNKQCSSKSNLVVHLRTHTGEKPYECTICNKKFGHSNSLRQHLRGHTGETPYECTICNKKFKGKPYRREEI

Sequence clustering based on sequence similarity using MMseqs2