Fase018873.1
Basic Information
- Insect
- Formica aserva
- Gene Symbol
- Sub1_1
- Assembly
- GCA_037039905.1
- Location
- JAXRKO010000016.1:3798385-3798931[-]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.26 1.3e+04 -2.8 0.3 29 37 28 37 25 37 0.72 2 2 1.3e-27 6.7e-23 81.4 0.4 1 51 47 98 47 99 0.96
Sequence Information
- Coding Sequence
- ATGCCAAAGTCAAAAGAATATGTGTCTGATAGCGATGACAGCAGCGAGGaggaAGTACAgtcaaagaaaaagaaacgacaGGATGAAGACGAGAAACCAGTAACAAAAAAGccgaaaaaagaagaagaagaaactaTCTGGGATTTGGGAAATAATCGTCAAGTGAATGTTAGGGATTTCAGAGGCAAATATTACGTAGATATCCGAGAAATGTATTATGACAAAGAGGGCGATTTGAAACCTGGCAAAAAAGgaaTATGCTTAACCATGCAACAATGGCGAAAATTTATGAATGTTGTGGAAGAGGTAGATAAAGTGGCAAAATCAAAGTGTTAA
- Protein Sequence
- MPKSKEYVSDSDDSSEEEVQSKKKKRQDEDEKPVTKKPKKEEEETIWDLGNNRQVNVRDFRGKYYVDIREMYYDKEGDLKPGKKGICLTMQQWRKFMNVVEEVDKVAKSKC
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01245231; iTF_00730745; iTF_00279975; iTF_01254804; iTF_01077475; iTF_00264281; iTF_00868807; iTF_00109838; iTF_00867408; iTF_00265005;
- 90% Identity
- iTF_01245231; iTF_00730745; iTF_00279975; iTF_00109838;
- 80% Identity
- iTF_00730745;